CKDdb-logoCKDdb - Extended molecular information molecule list

Molecule IDMassGeneName
2610015P09Rik 2610015P09RikCoiled-coil domain-containing protein KIAA1407KmDELLK
2610015P09Rik 2610015P09RikCoiled-coil domain-containing protein KIAA1407KmDELLK
2610015P09Rik 2610015P09RikCoiled-coil domain-containing protein KIAA1407IqELEAVAK
2610015P09Rik 2610015P09RikCoiled-coil domain-containing protein KIAA1407HNIEVAEKYHSLALQR
2610015P09Rik 2610015P09RikCoiled-coil domain-containing protein KIAA1407YcFGEWQRWHGSEVIK
4932429P05Rik 4932429P05RikMCG1037263IYcIcTnDMGLKVK
A0001 Grin1Glutamate [NMDA] receptor subunit zeta-1TWVRYQEcDSR
A0001 Grin1Glutamate [NMDA] receptor subunit zeta-1GALqNqKDTVLPR
A0001 Grin1Glutamate [NMDA] receptor subunit zeta-1TWVRYQEcDSR
A0001 Grin1Glutamate [NMDA] receptor subunit zeta-1GALqNqKDTVLPR
A0001 Grin1Glutamate [NMDA] receptor subunit zeta-1TWVRYQEcDSR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9EEEVEqLTGVVEK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9TDKVSSSGNQTLqILLR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9TRnWVLQQK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9QLqEFEAAIKqR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9qnTELTRLInQLTEEK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9KFLDEqAIDR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9qIVQmK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9GqTASSLLWR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9RLGAIqSGSTTqFHFGmR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9IqPVSEHqAR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9ARQTIAEQEnR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9qAYLnTISSLK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9SEEMnLqInELQK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9qKEITnLEEQLEqFR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9QLLnESqQKIESQK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9DVFqqEIqKLEHqLK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9GQTASSLLWR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9VLLEELEALK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9QQIDGLqnEmnR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9EmEnTLKSDTnAAISK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9VIEEqKEqIQDLETqIER
A0009 Akap9Isoform 3 of A-kinase anchor protein 9RLnEqLTqK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9DELISAqqKK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9QLEKmR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9LAEVESR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9nTQLnLLLEqqK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9qLEKMR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9LTDLQRSLEK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9LINQLTEEK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9EEEVEqLTGVVEK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9TDKVSSSGNQTLqILLR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9TRnWVLQQK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9QLqEFEAAIKqR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9qnTELTRLInQLTEEK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9KFLDEqAIDR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9qIVQmK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9GqTASSLLWR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9RLGAIqSGSTTqFHFGmR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9IqPVSEHqAR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9qKEITnLEEQLEqFR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9GQTASSLLWR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9VLLEELEALK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9EmEnTLKSDTnAAISK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9VIEEqKEqIQDLETqIER
A0009 Akap9Isoform 3 of A-kinase anchor protein 9DELISAqqKK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9QLEKmR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9LAEVESR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9nTQLnLLLEqqK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9qLEKMR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9LTDLQRSLEK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9LINQLTEEK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9EEEVEqLTGVVEK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9TDKVSSSGNQTLqILLR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9TRnWVLQQK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9qnTELTRLInQLTEEK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9RLGAIqSGSTTqFHFGmR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9qAYLnTISSLK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9QLLnESqQKIESQK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9LAEVESR
A0009 Akap9Isoform 3 of A-kinase anchor protein 9nTQLnLLLEqqK
A0009 Akap9Isoform 3 of A-kinase anchor protein 9LINQLTEEK
A0015 Dlg1Disks large homolog 1EQMMNSSVSSGSGSLR
A0015 Dlg1Disks large homolog 1QIIEEQSGPYIWVPAK
A0015 Dlg1Disks large homolog 1IITGGAAAQDGR
A0015 Dlg1Disks large homolog 1GDKGqSFNDK
A0015 Dlg1Disks large homolog 1EQMMNSSVSSGSGSLR
A0015 Dlg1Disks large homolog 1QIIEEQSGPYIWVPAK
A0015 Dlg1Disks large homolog 1IITGGAAAQDGR
A0019 FynTyrosine-protein kinase FynIADFGLAR
A0019 FynTyrosine-protein kinase FynIADFGLAR
A001A Mup8Major urinary proteins 11 and 8AGEYSVTYDGFNTFTIPK
A001A Mup8Major urinary proteins 11 and 8ENIIDLSNANR
A001A Mup8Major urinary proteins 11 and 8EPDLSSDIKER
A001A Mup8Major urinary proteins 11 and 8EKIEDNGNFR
A001A Mup8Major urinary proteins 11 and 8TDYDNFLMAHLINEK
A001A Mup8Major urinary proteins 11 and 8FAQLcEEHGILR
A001A Mup8Major urinary proteins 11 and 8DGETFQLMGLYGR
A0026 HttHuntingtinQVADIILPmLAK
A0026 HttHuntingtinQIIGIPK
A0026 HttHuntingtinLVSFLEAK
A0026 HttHuntingtinLHDVLKATHANYK
A0029 Anxa6Annexin A6TLIEILATR
A0029 Anxa6Annexin A6SELDMLDIR
A0029 Anxa6Annexin A6AINEAYKEDYHK
A0029 Anxa6Annexin A6QEIcQNYKSLYGK
A0029 Anxa6Annexin A6SLYSmIK
A0029 Anxa6Annexin A6TTGKPIEASIR
A0029 Anxa6Annexin A6GELSGDFEK
A0029 Anxa6Annexin A6cLIEILASR
A0029 Anxa6Annexin A6IAQGAMYR
A0029 Anxa6Annexin A6TNEQMHQLVAAYK
A0029 Anxa6Annexin A6DLIEDLKYELTGK
A0029 Anxa6Annexin A6MLVVLLqGTR
A0029 Anxa6Annexin A6SEISGDLAR
A0029 Anxa6Annexin A6DAFVAIVQSVK
A0029 Anxa6Annexin A6SEIDLLnIR
A0029 Anxa6Annexin A6STPEYFAER
A0029 Anxa6Annexin A6SEIDLLNIR
A0029 Anxa6Annexin A6LVFDEYLK
A0030 Ptk2bProtein-tyrosine kinase 2-betaVVAnLAHPPAE
A0030 Ptk2bProtein-tyrosine kinase 2-betaIGPnIqLAEcYGLRLK
A0030 Ptk2bProtein-tyrosine kinase 2-betaDmPHNALDKK
A0030 Ptk2bProtein-tyrosine kinase 2-betaQVLERQqK
A0030 Ptk2bProtein-tyrosine kinase 2-betaNLLDAVDQAK
A0038 Lphn1Latrophilin-1GTMGNHLLTNPVLQPR
A0038 Lphn1Latrophilin-1VVFILYnnLGLFLSTEnATVK
A0038 Lphn1Latrophilin-1mWNDTVR
A0038 Lphn1Latrophilin-1HIHQVSLGPR
A0038 Lphn1Latrophilin-1GTMGNHLLTNPVLQPR
A0038 Lphn1Latrophilin-1VVFILYnnLGLFLSTEnATVK
A0038 Lphn1Latrophilin-1VDYAFNTNANR
A0038 Lphn1Latrophilin-1mWNDTVR
A0039 Syt1Synaptotagmin-1NAINMKDVK
A0039 Syt1Synaptotagmin-1IHLMQNGKR
A0039 Syt1Synaptotagmin-1VFLLPDKK
A0048 Gna15Guanine nucleotide-binding protein subunit alpha-15LLIYQNIFVSmQAmIDAMDR
A0048 Gna15Guanine nucleotide-binding protein subunit alpha-15QHASLVmTQDPYK
A004C GltpGlycolipid transfer proteinFKTLqNILEVEK
A004C GltpGlycolipid transfer proteinYHGWLVQKIFK
A004C GltpGlycolipid transfer proteinVNANKAYEMALK
A004C GltpGlycolipid transfer proteinFKTLqNILEVEK
A004C GltpGlycolipid transfer proteinYHGWLVQKIFK
A004C GltpGlycolipid transfer proteinVNANKAYEMALK
A004D Ccdc83Coiled-coil domain-containing protein 83NLDEAPIVTR
A004D Ccdc83Coiled-coil domain-containing protein 83ISRETmIqLK
A004D Ccdc83Coiled-coil domain-containing protein 83EKWEFER
A004D Ccdc83Coiled-coil domain-containing protein 83EYWEEYK
A004D Ccdc83Coiled-coil domain-containing protein 83NLDEAPIVTR
A004D Ccdc83Coiled-coil domain-containing protein 83EYWEEYK
A004D Ccdc83Coiled-coil domain-containing protein 83NLDEAPIVTR
A004D Ccdc83Coiled-coil domain-containing protein 83ISRETmIqLK
A004D Ccdc83Coiled-coil domain-containing protein 83EKWEFER
A004D Ccdc83Coiled-coil domain-containing protein 83EYWEEYK
A004G Cops7bCOP9 signalosome complex subunit 7bESLPELSVAQQNK
A005C Blzf1Golgin-45qNRDAqSAIqDLLSER
A005C Blzf1Golgin-45qNRDAqSAIqDLLSER
A005H Kctd21BTB/POZ domain-containing protein KCTD21mSDPITLNVGGK
A006H Kcnip1Kv channel-interacting protein 1SLQLFqNVM
A007D Ccdc87Coiled-coil domain-containing protein 87LQqmIKSLQEEEASGK
A007D Ccdc87Coiled-coil domain-containing protein 87LDmVIKYSSNAR
A0088 F11rJunctional adhesion molecule A precursorVIYSQPSTR
A0089 Ctnna1Catenin alpha-1SDALnSAIDK
A0089 Ctnna1Catenin alpha-1AIMAQLPQEQK
A0089 Ctnna1Catenin alpha-1NAGNEQDLGIQYK
A0089 Ctnna1Catenin alpha-1EYAQVFREHANK
A0089 Ctnna1Catenin alpha-1EYAQVFREHAnK
A0089 Ctnna1Catenin alpha-1SqGmASLNLPAVSWKMK
A0089 Ctnna1Catenin alpha-1SAAGEFADDPcSSVKR
A0089 Ctnna1Catenin alpha-1EYAQVFR
A0089 Ctnna1Catenin alpha-1IVAEcNAVR
A0089 Ctnna1Catenin alpha-1LVYDGIR
A0089 Ctnna1Catenin alpha-1SAAGEFADDPcSSVK
A0089 Ctnna1Catenin alpha-1cVIALQEK
A0089 Ctnna1Catenin alpha-1EELVVAVEDVR
A0089 Ctnna1Catenin alpha-1TSVQTEDDQLIAGQSAR
A0089 Ctnna1Catenin alpha-1LIEVANLAcSISNNEEGVK
A0089 Ctnna1Catenin alpha-1NTSDVISAAK
A0089 Ctnna1Catenin alpha-1IVAEcnAVRqALqDLLSEYMGnAGR
A0089 Ctnna1Catenin alpha-1LESIISGAALMADSScTR
A0089 Ctnna1Catenin alpha-1AImAqLPqEQK
A0089 Ctnna1Catenin alpha-1IAEQVASFQEEK
A0089 Ctnna1Catenin alpha-1QIIVDPLSFSEER
A0089 Ctnna1Catenin alpha-1QALQDLLSEYmGNAGR
A0089 Ctnna1Catenin alpha-1mTAVHAGnInFKWDPK
A0090 OclnOccludinRnFDAGLQEYK
A0090 OclnOccludinSLQAELDDVNK
A0090 OclnOccludinYDKSnILWDK
A0095 Dnm1Dynamin-1GYIGVVnRSQK
A0095 Dnm1Dynamin-1FPFELVK
A0095 Dnm1Dynamin-1DLMPKTIMHLmInnTK
A0095 Dnm1Dynamin-1LqQYPR
A0095 Dnm1Dynamin-1FPFELVK
A0095 Dnm1Dynamin-1DLMPKTIMHLmInnTK
A0095 Dnm1Dynamin-1LqQYPR
A0095 Dnm1Dynamin-1GYIGVVnRSQK
A0095 Dnm1Dynamin-1FPFELVK
A0095 Dnm1Dynamin-1DMLmQFVTK
A0095 Dnm1Dynamin-1LqQYPR
A0098 VclVinculinTISPMVMDAK
A0098 VclVinculinNQWIDNVEK
A0098 VclVinculinGQGASPVAMQK
A0098 VclVinculinMSAEINEIIR
A0098 VclVinculinSTVEGIqASVK
A0098 VclVinculinGVGQAAIR
A0098 VclVinculinKLEAMTNSK
A0098 VclVinculinQQELTHQEHR
A0098 VclVinculinGLVAEGHR
A0098 VclVinculinLEAMTnSKqSIAK
A0098 VclVinculinALASIDSK
A0098 VclVinculinSFLDSGYR
A0098 VclVinculinAAVHLEGK
A0098 VclVinculinQILDEAGK
A0098 VclVinculinELTPQVISAAR
A0098 VclVinculinWIDNPTVDDR
A0098 VclVinculinALASQLQDSLK
A0098 VclVinculinNQGIEEALK
A0098 VclVinculinDYLIDGSR
A0098 VclVinculinSTVEGIQASVK
A0098 VclVinculinSLGEIAALTSK
A0098 VclVinculinTDAGFTLR
A0098 VclVinculinTNLLQVcER
A0098 VclVinculinKLEAmTNSK
A0098 VclVinculinLcFnqNPnR
A0098 VclVinculinTNLLQVcER
A0100 Sorbs1Sorbin and SH3 domain-containing protein 1SATVSPQQPqAQQRR
A0100 Sorbs1Sorbin and SH3 domain-containing protein 1ELPLqKGDVVYIYR
A0100 Sorbs1Sorbin and SH3 domain-containing protein 1LSSLSDPASER
A0100 Sorbs1Sorbin and SH3 domain-containing protein 1TPVDYIDLPYSSSPSR
A0100 Sorbs1Sorbin and SH3 domain-containing protein 1SATVSPQQPQAQQR
A0100 Sorbs1Sorbin and SH3 domain-containing protein 1SATVSPQQPqAQQRR
A0100 Sorbs1Sorbin and SH3 domain-containing protein 1ELPLqKGDVVYIYR
A0100 Sorbs1Sorbin and SH3 domain-containing protein 1TPVDYIDLPYSSSPSR
A0100 Sorbs1Sorbin and SH3 domain-containing protein 1SAESLLESTK
A0100 Sorbs1Sorbin and SH3 domain-containing protein 1SATVSPQQPQAQQR
A0100 Sorbs1Sorbin and SH3 domain-containing protein 1SVLLPSEK
A0100 Sorbs1Sorbin and SH3 domain-containing protein 1LSSRHTMAR
A0103 Grm1Metabotropic glutamate receptor 1GLLSAmR
A0103 Grm1Metabotropic glutamate receptor 1LLVGLSSAMcYSALVTK
A0103 Grm1Metabotropic glutamate receptor 1GLLSAmR
A0103 Grm1Metabotropic glutamate receptor 1LLVGLSSAMcYSALVTK
A0104 Homer1Homer protein homolog 1TPDVTQNSEPRAEPTqNALPFPHSSAISK
A0104 Homer1Homer protein homolog 1NWVPTSK
A0112 Ctnnb1Catenin beta-1LLNDEDQVVVNK
A0112 Ctnnb1Catenin beta-1EGLLAIFKSGGIPALVK
A0112 Ctnnb1Catenin beta-1HQEAEMAQNAVR
A0112 Ctnnb1Catenin beta-1TMQNTNDVETAR
A0112 Ctnnb1Catenin beta-1HAVVNLINYQDDAELATR
A0112 Ctnnb1Catenin beta-1MEEIVEGcTGALHILAR
A0112 Ctnnb1Catenin beta-1SPqMVSAIVR
A0112 Ctnnb1Catenin beta-1mmVcqVGGIEALVR
A0112 Ctnnb1Catenin beta-1HQEAEMAQNAVR
A0112 Ctnnb1Catenin beta-1MEEIVEGcTGALHILAR
A0112 Ctnnb1Catenin beta-1xcQVGGIEALVRTVLR
A0112 Ctnnb1Catenin beta-1LLNDEDQVVVNK
A0112 Ctnnb1Catenin beta-1EGLLAIFKSGGIPALVK
A0112 Ctnnb1Catenin beta-1HQEAEMAQNAVR
A0112 Ctnnb1Catenin beta-1TMQNTNDVETAR
A0112 Ctnnb1Catenin beta-1HAVVNLINYQDDAELATR
A0112 Ctnnb1Catenin beta-1SPqMVSAIVR
A0121 AmphAmphiphysinnVSSLEAKFHK
A0121 AmphAmphiphysinEDVKMVGEK
A0123 Ppp3caSerine/threonine-protein phosphatase 2B catalytic subunit alpha isoformEESESVLTLK
A0123 Ppp3caSerine/threonine-protein phosphatase 2B catalytic subunit alpha isoformYEnnVMNIR
A0123 Ppp3caSerine/threonine-protein phosphatase 2B catalytic subunit alpha isoformITSFEEAKGLDR
A0123 Ppp3caSerine/threonine-protein phosphatase 2B catalytic subunit alpha isoformEESESVLTLK
A0123 Ppp3caSerine/threonine-protein phosphatase 2B catalytic subunit alpha isoformqEcKIK
A0123 Ppp3caSerine/threonine-protein phosphatase 2B catalytic subunit alpha isoformYEnnVMNIR
A0123 Ppp3caSerine/threonine-protein phosphatase 2B catalytic subunit alpha isoformITSFEEAKGLDR
A0136 Klc1Kinesin light chain 1QGKFEAAETLEEAAmR
A0136 Klc1Kinesin light chain 1QGKFEAAETLEEAAmR
A0136 Klc1Kinesin light chain 1QGKFEAAETLEEAAmR
A0136 Klc1Kinesin light chain 1ESLNmDVVKYESGPDGGEEGIPR
A013B SltmSAFB-like transcription modulatorAGAGMITqHSSTASPVnR
A013B SltmSAFB-like transcription modulatorDVqDAIAqSPEKEAK
A0140 Apba2Amyloid beta A4 precursor protein-binding family A member 2IIEInGqSVVATAHEK
A0140 Apba2Amyloid beta A4 precursor protein-binding family A member 2IIEInGqSVVATAHEK
A0147 Ppp1caSerine/threonine-protein phosphatase PP1-alpha catalytic subunitHDLDLIcR
A0147 Ppp1caSerine/threonine-protein phosphatase PP1-alpha catalytic subunitAHQVVEDGYEFFAK
A0147 Ppp1caSerine/threonine-protein phosphatase PP1-alpha catalytic subunitTFTDcFNcLPIAAIVDEK
A0147 Ppp1caSerine/threonine-protein phosphatase PP1-alpha catalytic subunitGNHEcASINR
A0147 Ppp1caSerine/threonine-protein phosphatase PP1-alpha catalytic subunitIcGDIHGQYYDLLR
A0147 Ppp1caSerine/threonine-protein phosphatase PP1-alpha catalytic subunitNVQLTENEIR
A0147 Ppp1caSerine/threonine-protein phosphatase PP1-alpha catalytic subunitIYGFYDEcK
A0147 Ppp1caSerine/threonine-protein phosphatase PP1-alpha catalytic subunitEIFLSQPILLELEAPLK
A0147 Ppp1caSerine/threonine-protein phosphatase PP1-alpha catalytic subunitIFccHGGLSPDLQSMEQIR
A0147 Ppp1caSerine/threonine-protein phosphatase PP1-alpha catalytic subunitHDLDLIcR
A0147 Ppp1caSerine/threonine-protein phosphatase PP1-alpha catalytic subunitAHQVVEDGYEFFAK
A0147 Ppp1caSerine/threonine-protein phosphatase PP1-alpha catalytic subunitTFTDcFNcLPIAAIVDEK
A0147 Ppp1caSerine/threonine-protein phosphatase PP1-alpha catalytic subunitIcGDIHGQYYDLLR
A0147 Ppp1caSerine/threonine-protein phosphatase PP1-alpha catalytic subunitIFccHGGLSPDLQSMEQIR
A0148 Wasf1Wiskott-Aldrich syndrome protein family member 1GIKNELEcVTnISLAnIIR
A0148 Wasf1Wiskott-Aldrich syndrome protein family member 1SVLLEAIR
A0148 Wasf1Wiskott-Aldrich syndrome protein family member 1EWQKLAQGPELAEDDADLLHK
A0149 Myo5aUnconventional myosin-VaLHIGmEnKImQLQR
A0149 Myo5aUnconventional myosin-VaLQATNARDALAK
A0149 Myo5aUnconventional myosin-VaSIEERADK
A0149 Myo5aUnconventional myosin-VaqLELDLNDER
A0149 Myo5aUnconventional myosin-VaAGQVAYLEK
A0149 Myo5aUnconventional myosin-VaGEIAQAYIGLK
A0149 Myo5aUnconventional myosin-VaIIGAnmRTYLLEK
A0149 Myo5aUnconventional myosin-VanKDTVFEEQIK
A0149 Myo5aUnconventional myosin-VaIEASLQHEITR
A0149 Myo5aUnconventional myosin-VaLKnELnELR
A0149 Myo5aUnconventional myosin-VaVLmKqK
A0149 Myo5aUnconventional myosin-VaEEMTLMLNVPKPGHK
A0149 Myo5aUnconventional myosin-VaLHIGmEnKImQLQR
A0149 Myo5aUnconventional myosin-VaLQATNARDALAK
A0149 Myo5aUnconventional myosin-VaSIEERADK
A0149 Myo5aUnconventional myosin-VaqLELDLNDER
A0149 Myo5aUnconventional myosin-VaAGQVAYLEK
A0149 Myo5aUnconventional myosin-VaNQSIIVSGESGAGK
A0149 Myo5aUnconventional myosin-VaqmFYIVGAITLnnLLLR
A0149 Myo5aUnconventional myosin-VaGEIAQAYIGLK
A0149 Myo5aUnconventional myosin-VaIIGAnmRTYLLEK
A0149 Myo5aUnconventional myosin-VanKDTVFEEQIK
A0149 Myo5aUnconventional myosin-VaIEASLQHEITR
A0149 Myo5aUnconventional myosin-VaLKnELnELR
A0149 Myo5aUnconventional myosin-VaVLmKqK
A0149 Myo5aUnconventional myosin-VaEEMTLMLNVPKPGHK
A0149 Myo5aUnconventional myosin-VaDTVFEEqIK
A0149 Myo5aUnconventional myosin-VaIEASLQHEITRLTnEnLDLmEQLEK
A0156 EgfrEpidermal growth factor receptorIMNnRAEK
A0157 Ntrk1High affinity nerve growth factor receptorEPqqRLSmK
A015A Nlrx1NLR family member X1EVVEFVGR
A015H Kcnh3Potassium voltage-gated channel subfamily H member 3EGLQSLR
A015H Kcnh3Potassium voltage-gated channel subfamily H member 3ALDEHKEFK
A016A Nomo1Nodal modulator 1VQVVVPEAETR
A016A Nomo1Nodal modulator 1SSIDSEPALVLGPLK
A016A Nomo1Nodal modulator 1SDGEPmKGVK
A016H Kcnh8Potassium voltage-gated channel subfamily H member 8TSFcAPGEYLLR
A0170 Mcf2lGuanine nucleotide exchange factor DBSQSLNmTAVGITEnVK
A0170 Mcf2lGuanine nucleotide exchange factor DBSQSLnmTAVGITEnVK
A0170 Mcf2lGuanine nucleotide exchange factor DBSQSLNmTAVGITEnVK
A0170 Mcf2lGuanine nucleotide exchange factor DBSQSLnmTAVGITEnVK
A0170 Mcf2lGuanine nucleotide exchange factor DBSASVLRIALPPmQR
A0170 Mcf2lGuanine nucleotide exchange factor DBSQSLNmTAVGITEnVK
A0170 Mcf2lGuanine nucleotide exchange factor DBSQSLnmTAVGITEnVK
A0170 Mcf2lGuanine nucleotide exchange factor DBSWLcHRTAIESFALMVK
A0170 Mcf2lGuanine nucleotide exchange factor DBSQSLNmTAVGITEnVK
A0170 Mcf2lGuanine nucleotide exchange factor DBSQSLnmTAVGITEnVK
A0170 Mcf2lGuanine nucleotide exchange factor DBSWLcHRTAIESFALMVK
A0170 Mcf2lGuanine nucleotide exchange factor DBSQSLNmTAVGITEnVK
A0170 Mcf2lGuanine nucleotide exchange factor DBSQSLnmTAVGITEnVK
A0170 Mcf2lGuanine nucleotide exchange factor DBSWLcHRTAIESFALMVK
A0170 Mcf2lGuanine nucleotide exchange factor DBSQSLNmTAVGITEnVK
A0170 Mcf2lGuanine nucleotide exchange factor DBSQSLnmTAVGITEnVK
A0170 Mcf2lGuanine nucleotide exchange factor DBSWLcHRTAIESFALMVK
A0170 Mcf2lGuanine nucleotide exchange factor DBSQSLNmTAVGITEnVK
A0170 Mcf2lGuanine nucleotide exchange factor DBSQSLnmTAVGITEnVK
A0170 Mcf2lGuanine nucleotide exchange factor DBSWLcHRTAIESFALMVK
A0170 Mcf2lGuanine nucleotide exchange factor DBSQSLnmTAVGITEnVK
A0178 Pkn2Serine/threonine-protein kinase N2DLKLDnLLLDTEGFVK
A0178 Pkn2Serine/threonine-protein kinase N2NLAYVDNILK
A017G CtifCBP80/20-dependent translation initiation factorLmEILnSmR
A017G CtifCBP80/20-dependent translation initiation factornnSSDVDAK
A018B Samd4aProtein Smaug homolog 1SVSLTPPMnVPnqPLGHGWmSHEDLR
A018B Samd4aProtein Smaug homolog 1VSQTQAR
A018B Samd4aProtein Smaug homolog 1QqVQKLFR
A018B Samd4aProtein Smaug homolog 1SVSLTPPMnVPnqPLGHGWmSHEDLR
A0192 Sh3kbp1SH3 domain-containing kinase-binding protein 1LRLqmEVNDIK
A019B Snrpd2Small nuclear ribonucleoprotein Sm D2SKSEmTPEELQK
A019B Snrpd2Small nuclear ribonucleoprotein Sm D2EMWTEVPK
A019B Snrpd2Small nuclear ribonucleoprotein Sm D2SEMTPEELQK
A019B Snrpd2Small nuclear ribonucleoprotein Sm D2HcNMVLENVK
A019B Snrpd2Small nuclear ribonucleoprotein Sm D2NNTQVLINcR
A019B Snrpd2Small nuclear ribonucleoprotein Sm D2SEMTPEELQK
A019B Snrpd2Small nuclear ribonucleoprotein Sm D2HcNMVLENVK
A019B Snrpd2Small nuclear ribonucleoprotein Sm D2NNTQVLINcR
A019B Snrpd2Small nuclear ribonucleoprotein Sm D2SEMTPEELQK
A019B Snrpd2Small nuclear ribonucleoprotein Sm D2NNTQVLINcR
A019J Ttc27Tetratricopeptide repeat protein 27LTALQSLPWWTLR
A0203 RalaRas-related protein Ral-AVIMVGSGGVGK
A0203 RalaRas-related protein Ral-ASALTLQFMYDEFVEDYEPTK
A0203 RalaRas-related protein Ral-AVKEDENVPFLLVGNK
A0203 RalaRas-related protein Ral-AmAANKPKGQNSLALHK
A0209 Ranbp1Ran-specific GTPase-activating proteinFLnAENAqKFK
A0209 Ranbp1Ran-specific GTPase-activating proteinERGTGDVK
A020B Snrpd3Small nuclear ribonucleoprotein Sm D3VAQLEQVYIR
A020B Snrpd3Small nuclear ribonucleoprotein Sm D3VLHEAEGHIVTcETNTGEVYR
A020B Snrpd3Small nuclear ribonucleoprotein Sm D3FLILPDMLK
A020B Snrpd3Small nuclear ribonucleoprotein Sm D3VAQLEqVYIRGSK
A0211 Rab3ipRab-3A-interacting proteinSPSVLEVREK
A0214 KalrnKalirinEFImAELLqTEKAYVR
A0214 KalrnKalirinEFImAELLqTEKAYVR
A0214 KalrnKalirinScTSVILR
A0214 KalrnKalirinEFImAELLqTEKAYVR
A0214 KalrnKalirinRcNDmMnLGR
A0214 KalrnKalirinScTSVILR
A0214 KalrnKalirinEFImAELLqTEKAYVR
A0214 KalrnKalirinRcNDmMnLGR
A0216 SlmapSarcolemmal membrane-associated proteinENVLLSSELqRQEK
A0216 SlmapSarcolemmal membrane-associated proteinDTEISSTRDK
A0216 SlmapSarcolemmal membrane-associated proteinLTALqVR
A0216 SlmapSarcolemmal membrane-associated proteinENVLLSSELqRQEK
A0216 SlmapSarcolemmal membrane-associated proteinDTEISSTRDK
A0216 SlmapSarcolemmal membrane-associated proteinTQEELR
A0216 SlmapSarcolemmal membrane-associated proteinLTALqVR
A0216 SlmapSarcolemmal membrane-associated proteinENVLLSSELqRQEK
A0216 SlmapSarcolemmal membrane-associated proteinDTEISSTRDK
A0216 SlmapSarcolemmal membrane-associated proteinENVLLSSELqRQEK
A0216 SlmapSarcolemmal membrane-associated proteinDTEISSTRDK
A0216 SlmapSarcolemmal membrane-associated proteinTQEELR
A0216 SlmapSarcolemmal membrane-associated proteinIEALqADNDFTnERLTALQEK
A0216 SlmapSarcolemmal membrane-associated proteinqIQVLQVqLQKLHmDmENLQEEK
A0216 SlmapSarcolemmal membrane-associated proteinnQVEESAKQIqVLqVqL
A0216 SlmapSarcolemmal membrane-associated proteinTQEELR
A0216 SlmapSarcolemmal membrane-associated proteinqIQVLQVqLQKLHmDmENLQEEK
A0217 FusRNA-binding protein FUSLKGEATVSFDDPPSAK
A0217 FusRNA-binding protein FUSTGQPMINLYTDR
A0217 FusRNA-binding protein FUSGEATVSFDDPPSAK
A0217 FusRNA-binding protein FUSAAIDWFDGK
A0217 FusRNA-binding protein FUSLKGEATVSFDDPPSAK
A0217 FusRNA-binding protein FUSTGQPMINLYTDR
A0217 FusRNA-binding protein FUSGEATVSFDDPPSAK
A0217 FusRNA-binding protein FUSAAIDWFDGK
A0218 CTNND1Catenin delta-1QDVYGPQPQVR
A0218 CTNND1Catenin delta-1SDFqVNLnnASR
A0218 CTNND1Catenin delta-1SLDNNYSTLNER
A0218 CTNND1Catenin delta-1GYELLFQPEVVR
A0218 CTNND1Catenin delta-1nKELIGK
A0218 CTNND1Catenin delta-1SALRQEK
A0218 CTNND1Catenin delta-1GYELLFQPEVVR
A0218 CTNND1Catenin delta-1nKELIGK
A0218 CTNND1Catenin delta-1QDVYGPQPQVR
A0218 CTNND1Catenin delta-1nKELIGK
A0218 CTNND1Catenin delta-1SALRQEK
A0218 CTNND1Catenin delta-1QDVYGPQPQVR
A0218 CTNND1Catenin delta-1SLDNNYSTLNER
A0218 CTNND1Catenin delta-1GYELLFQPEVVR
A0218 CTNND1Catenin delta-1nKELIGK
A0218 CTNND1Catenin delta-1SALRQEK
A0218 CTNND1Catenin delta-1QDVYGPQPQVR
A0218 CTNND1Catenin delta-1SDFqVNLnnASR
A0218 CTNND1Catenin delta-1SLDNNYSTLNER
A0218 CTNND1Catenin delta-1GYELLFQPEVVR
A0218 CTNND1Catenin delta-1nKELIGK
A0218 CTNND1Catenin delta-1SALRQEK
A021I QrfprPyroglutamylated RFamide peptide receptorMVPFVQcTAIVTEILTmTcIAVERHqGLVHPFK
A021I QrfprPyroglutamylated RFamide peptide receptorMVPFVQcTAIVTEILTmTcIAVERHqGLVHPFK
A0223 PtprfReceptor-type tyrosine-protein phosphatase FEFKVTDAR
A0233 Arpc2Actin-related protein 2/3 complex subunit 2DSIVHqAGMLK
A0233 Arpc2Actin-related protein 2/3 complex subunit 2YFQFQEEGKEGENR
A0233 Arpc2Actin-related protein 2/3 complex subunit 2VFMQEFK
A0233 Arpc2Actin-related protein 2/3 complex subunit 2DSIVHQAGMLK
A0233 Arpc2Actin-related protein 2/3 complex subunit 2MILLEVNNR
A0233 Arpc2Actin-related protein 2/3 complex subunit 2VYGSFLVNPEPGYNVSLLYDLENLPASK
A0233 Arpc2Actin-related protein 2/3 complex subunit 2AKTSDFLK
A0233 Arpc2Actin-related protein 2/3 complex subunit 2ELQAHGADELLK
A0233 Arpc2Actin-related protein 2/3 complex subunit 2NcFASVFEK
A0233 Arpc2Actin-related protein 2/3 complex subunit 2YFQFQEEGKEGENR
A0233 Arpc2Actin-related protein 2/3 complex subunit 2VFMQEFK
A0233 Arpc2Actin-related protein 2/3 complex subunit 2DSIVHQAGMLK
A0233 Arpc2Actin-related protein 2/3 complex subunit 2NcFASVFEK
A0235 Actr2Actin-related protein 2HLWDYTFGPEK
A0235 Actr2Actin-related protein 2ILLTEPPMNPTK
A0235 Actr2Actin-related protein 2VGNIEIK
A0235 Actr2Actin-related protein 2VVVcDNGTGFVK
A0235 Actr2Actin-related protein 2SMLEVNYPMENGIVR
A0235 Actr2Actin-related protein 2LcYVGYNIEQEQK
A0235 Actr2Actin-related protein 2QLYLER
A0238 Stxbp1Syntaxin-binding protein 1DLSQMLKK
A0238 Stxbp1Syntaxin-binding protein 1DLSQMLKK
A0248 PxnPaxillinEQNDKPYcQScFVK
A0251 Ap2a1AP-2 complex subunit alpha-1EPVSRHLcELLAqqF
A0251 Ap2a1AP-2 complex subunit alpha-1NADVELQQR
A0251 Ap2a1AP-2 complex subunit alpha-1AADLLYAmcDRSNAK
A0251 Ap2a1AP-2 complex subunit alpha-1LEPNAQAQMYR
A0251 Ap2a1AP-2 complex subunit alpha-1QSAALcLLR
A0251 Ap2a1AP-2 complex subunit alpha-1VGGYILGEFGNLIAGDPR
A0251 Ap2a1AP-2 complex subunit alpha-1FFQPTEmAAQDFFQR
A0251 Ap2a1AP-2 complex subunit alpha-1YLALESMcTLASSEFSHEAVK
A0251 Ap2a1AP-2 complex subunit alpha-1SNAKQIVSEMLR
A0251 Ap2a1AP-2 complex subunit alpha-1LEPNAqAQMYRLTLR
A0251 Ap2a1AP-2 complex subunit alpha-1FFQPTEmAAQDFFQR
A0251 Ap2a1AP-2 complex subunit alpha-1xADLLGLR
A0251 Ap2a1AP-2 complex subunit alpha-1QSAALcLLR
A0254 Ap2m1AP-2 complex subunit muQSIAIDDcTFHQcVR
A0254 Ap2m1AP-2 complex subunit muSYLSGMPEcK
A0254 Ap2m1AP-2 complex subunit muLNYSDHDVIK
A0254 Ap2m1AP-2 complex subunit muSISFIPPDGEFELMR
A0254 Ap2m1AP-2 complex subunit muQSIAIDDcTFHQcVR
A0254 Ap2m1AP-2 complex subunit muSYLSGMPEcK
A0254 Ap2m1AP-2 complex subunit muNAVDAFR
A0254 Ap2m1AP-2 complex subunit muLNYSDHDVIK
A0254 Ap2m1AP-2 complex subunit muTFITQQGIK
A0254 Ap2m1AP-2 complex subunit muSISFIPPDGEFELMR
A0255 Ap2s1AP-2 complex subunit sigmaQLLMLQSLE
A0255 Ap2s1AP-2 complex subunit sigmaQLLMLQSLE
A025I R3hdm2R3H domain-containing protein 2LVEESVnK
A0264 Snta1Alpha-1-syntrophinDELqALLTATGTAGSqDIK
A026C Hook2Protein Hook homolog 2qVRqLEER
A026C Hook2Protein Hook homolog 2QVqELQGqWQEEAmK
A026C Hook2Protein Hook homolog 2REYIEELEPPTDSSTAR
A026C Hook2Protein Hook homolog 2qVRqLEER
A026C Hook2Protein Hook homolog 2QVqELQGqWQEEAmK
A0276 CitCitron Rho-interacting kinasemEVSqEDDKALqLLHDIR
A0276 CitCitron Rho-interacting kinaseRVASSPAPPEGPSHPR
A0276 CitCitron Rho-interacting kinaseEVSLEHEEqK
A0276 CitCitron Rho-interacting kinaseWSRLPLAFAYR
A0276 CitCitron Rho-interacting kinasecAELEEALQKTR
A0276 CitCitron Rho-interacting kinaseAEILALQQALK
A0276 CitCitron Rho-interacting kinaseLEKInAEQQLK
A0276 CitCitron Rho-interacting kinaseLVEAEERR
A0276 CitCitron Rho-interacting kinaseVLIYDnEAR
A0276 CitCitron Rho-interacting kinasemEVSqEDDKALqLLHDIR
A0276 CitCitron Rho-interacting kinaseRVASSPAPPEGPSHPR
A0276 CitCitron Rho-interacting kinaseKESSTPEEFSR
A0276 CitCitron Rho-interacting kinaseESQLTALQAARAALESqLR
A0276 CitCitron Rho-interacting kinaseVLDNQIK
A0276 CitCitron Rho-interacting kinaseEVSLEHEEqK
A0276 CitCitron Rho-interacting kinaseLVEAELEEK
A0276 CitCitron Rho-interacting kinaseWSRLPLAFAYR
A0276 CitCitron Rho-interacting kinasecAELEEALQKTR
A0276 CitCitron Rho-interacting kinaseAEILALQQALK
A0276 CitCitron Rho-interacting kinaseLEKInAEQQLK
A0276 CitCitron Rho-interacting kinaseVLIYDnEAR
A0276 CitCitron Rho-interacting kinasemEVSqEDDKALqLLHDIR
A0276 CitCitron Rho-interacting kinaseAEILALQQALK
A0276 CitCitron Rho-interacting kinaseVLIYDnEAR
A0276 CitCitron Rho-interacting kinasemEVSqEDDKALqLLHDIR
A0276 CitCitron Rho-interacting kinaseRVASSPAPPEGPSHPR
A0276 CitCitron Rho-interacting kinaseKESSTPEEFSR
A0276 CitCitron Rho-interacting kinaseESQLTALQAARAALESqLR
A0276 CitCitron Rho-interacting kinaseVLDNQIK
A0276 CitCitron Rho-interacting kinaseEVSLEHEEqK
A0276 CitCitron Rho-interacting kinaseWSRLPLAFAYR
A0276 CitCitron Rho-interacting kinasecAELEEALQKTR
A0276 CitCitron Rho-interacting kinaseAEILALQQALK
A0276 CitCitron Rho-interacting kinaseLEKInAEQQLK
A0276 CitCitron Rho-interacting kinaseLVEAEERR
A0276 CitCitron Rho-interacting kinaseVLIYDnEAR
A0276 CitCitron Rho-interacting kinasemEVSqEDDKALqLLHDIR
A0276 CitCitron Rho-interacting kinaseRVASSPAPPEGPSHPR
A0276 CitCitron Rho-interacting kinaseEVSLEHEEqK
A0276 CitCitron Rho-interacting kinaseWSRLPLAFAYR
A0276 CitCitron Rho-interacting kinasecAELEEALQKTR
A0276 CitCitron Rho-interacting kinaseAEILALQQALK
A0276 CitCitron Rho-interacting kinaseLEKInAEQQLK
A0276 CitCitron Rho-interacting kinaseVLIYDnEAR
A027C Hook3Protein Hook homolog 3VSKLEGQVESYK
A027C Hook3Protein Hook homolog 3VSKLEGQVESYK
A027C Hook3Protein Hook homolog 3KnELETEnR
A027C Hook3Protein Hook homolog 3HLQLQTqLEqLqEETFR
A0284 SafbScaffold attachment factor B1YPNHSVDRR
A028D Cystm1Cysteine-rich and transmembrane domain-containing protein 1TTVYVVEDQR
A0291 Dsg1aDesmoglein-1-alphaGTVLSIDDSLQR
A0295 Ppp2r1aSerine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoformENVIMTqILPcIK
A0295 Ppp2r1aSerine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoformFNVAKSLqK
A0295 Ppp2r1aSerine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoformIGPILDNSTLQSEVKPILEK
A0295 Ppp2r1aSerine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoformMAGDPVANVR
A0295 Ppp2r1aSerine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoformLTQDQDVDVK
A0295 Ppp2r1aSerine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoformVLAMSGDPNYLHR
A0295 Ppp2r1aSerine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoformAISHEHSPSDLEAHFVPLVK
A0295 Ppp2r1aSerine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoformVKEFcENLSADcR
A0295 Ppp2r1aSerine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoformVLELDNVK
A0295 Ppp2r1aSerine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoformNLcSDDTPMVR
A0295 Ppp2r1aSerine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoformLNIISNLDcVNEVIGIR
A0295 Ppp2r1aSerine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoformENVIMTqILPcIK
A0295 Ppp2r1aSerine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoformVLELDNVK
A0297 Gria2Glutamate receptor 2WqVTAInVGnINNDK
A0297 Gria2Glutamate receptor 2InYTINImELK
A029J Ttll8Protein monoglycylase TTLL8KFnFFPK
A029J Ttll8Protein monoglycylase TTLL8VAqDHVEARK
A029J Ttll8Protein monoglycylase TTLL8SLSTGVGGqK
A029J Ttll8Protein monoglycylase TTLL8qLTEKAIK
A029J Ttll8Protein monoglycylase TTLL8LDSAIHLcNNSIqRR
A0305 Prkar2acAMP-dependent protein kinase type II-alpha regulatory subunitAASAYAVGDVK
A0305 Prkar2acAMP-dependent protein kinase type II-alpha regulatory subunitIVDVIGEK
A030H Keap1Kelch-like ECH-associated protein 1LADLqVPR
A030H Keap1Kelch-like ECH-associated protein 1mITPmNTIR
A0315 Ptpn6Tyrosine-protein phosphatase non-receptor type 6VIVmTTR
A0315 Ptpn6Tyrosine-protein phosphatase non-receptor type 6VIVmTTR
A0315 Ptpn6Tyrosine-protein phosphatase non-receptor type 6VIVMTTREnK
A0315 Ptpn6Tyrosine-protein phosphatase non-receptor type 6VIVmTTR
A0317 Capn1Calpain-1 catalytic subunitmAIEAAGFKLnK
A0317 Capn1Calpain-1 catalytic subunitYLGQDYETLR
A0317 Capn1Calpain-1 catalytic subunitnYLTIFR
A0317 Capn1Calpain-1 catalytic subunitTNGFSLEScRSMVNLMDR
A0317 Capn1Calpain-1 catalytic subunitLEIcNLTPDALKSR
A0317 Capn1Calpain-1 catalytic subunitAGTqELDDQIQANLPDEK
A0318 Cdh1Cadherin-1KDLEIGEYK
A031B SnrpaU1 small nuclear ribonucleoprotein AEVTSATNALR
A031B SnrpaU1 small nuclear ribonucleoprotein AEVTSATNALR
A031B SnrpaU1 small nuclear ribonucleoprotein AEVTSATNALR
A032B Sart1U4/U6.U5 tri-snRNP-associated protein 1DKGVLqDGEDVLVnVNMVDK
A032B Sart1U4/U6.U5 tri-snRNP-associated protein 1qLQqLQqLR
A032B Sart1U4/U6.U5 tri-snRNP-associated protein 1QLQQLQQLRDSGEK
A032B Sart1U4/U6.U5 tri-snRNP-associated protein 1QLqQLQQLR
A032B Sart1U4/U6.U5 tri-snRNP-associated protein 1AqKTPYIVLSGSGK
A032B Sart1U4/U6.U5 tri-snRNP-associated protein 1LLnQKLGK
A032B Sart1U4/U6.U5 tri-snRNP-associated protein 1EAFRqLSHR
A034I Rab44Ras-related protein Rab-44TFALqLWDTAGQER
A034I Rab44Ras-related protein Rab-44GqLQVTR
A034I Rab44Ras-related protein Rab-44VKnLLVDNK
A035J  T-cell receptor alpha chain V region PHDS58DAqAqSVTqPDAR
A0363 Rab2aRas-related protein Rab-2ALQIWDTAGQESFR
A0363 Rab2aRas-related protein Rab-2ADTFNHLTTWLEDAR
A0363 Rab2aRas-related protein Rab-2AEHGLIFMETSAK
A0363 Rab2aRas-related protein Rab-2AMITIDGK
A0363 Rab2aRas-related protein Rab-2AFQPVHDLTIGVEFGAR
A0363 Rab2aRas-related protein Rab-2ATASNVEEAFINTAK
A0363 Rab2aRas-related protein Rab-2AIQEGVFDINNEANGIK
A0363 Rab2aRas-related protein Rab-2AYIIIGDTGVGK
A0366 Rpl760S ribosomal protein L7QIFnGTFVKLnK
A0366 Rpl760S ribosomal protein L7SVNELIYK
A0366 Rpl760S ribosomal protein L7ASINMLR
A0366 Rpl760S ribosomal protein L7QIFNGTFVK
A0366 Rpl760S ribosomal protein L7GINGVSPK
A0366 Rpl760S ribosomal protein L7FKEAnnFLWPFK
A0366 Rpl760S ribosomal protein L7KAGNFYVPAEPK
A0366 Rpl760S ribosomal protein L7VATVPGTLK
A0366 Rpl760S ribosomal protein L7TTHFVEGGDAGNREDQINR
A0366 Rpl760S ribosomal protein L7AGNFYVPAEPK
A0366 Rpl760S ribosomal protein L7IALTDNSLIAR
A0366 Rpl760S ribosomal protein L7SVNELIYK
A0366 Rpl760S ribosomal protein L7GINGVSPK
A0366 Rpl760S ribosomal protein L7FKEAnnFLWPFK
A0366 Rpl760S ribosomal protein L7KAGNFYVPAEPK
A0366 Rpl760S ribosomal protein L7AGNFYVPAEPK
A0366 Rpl760S ribosomal protein L7SVNELIYK
A0366 Rpl760S ribosomal protein L7ASINMLR
A0366 Rpl760S ribosomal protein L7qIALTDnSLIAR
A0366 Rpl760S ribosomal protein L7FKEAnnFLWPFK
A0366 Rpl760S ribosomal protein L7QIFNGTFAKLnK
A0366 Rpl760S ribosomal protein L7VATVPGTLK
A0366 Rpl760S ribosomal protein L7TTHFVEGGDAGNREDQINR
A0366 Rpl760S ribosomal protein L7QIALTDNSLIAR
A0366 Rpl760S ribosomal protein L7qIFNGTFAKLnK
A0376 NefmNeurofilament medium polypeptideDTKEEKPqPQEK
A0376 NefmNeurofilament medium polypeptideEIEAEIqALR
A0376 NefmNeurofilament medium polypeptideSPqESKK
A0376 NefmNeurofilament medium polypeptideVEEVAVK
A0376 NefmNeurofilament medium polypeptideEYQDLLNVK
A0376 NefmNeurofilament medium polypeptideVHYLEqQNK
A0385 Atp5g2ATP synthase lipid-binding protein, mitochondrialSTSQLLSRPLSAVELK
A038H Kirrel3Kin of IRRE-like protein 3LKEQGSEMK
A039H Kiss1Metastasis-suppressor KiSS-1GAVLVQREK
A0402 Atp6v1dV-type proton ATPase subunit DEAAFSLAEAK
A0402 Atp6v1dV-type proton ATPase subunit DMLMGEVMR
A0402 Atp6v1dV-type proton ATPase subunit DmLmGEVMREAAFSLAEAK
A0402 Atp6v1dV-type proton ATPase subunit DIEIFPSR
A0402 Atp6v1dV-type proton ATPase subunit DMAQTIMK
A0402 Atp6v1dV-type proton ATPase subunit DVNAIEHVIIPR
A0402 Atp6v1dV-type proton ATPase subunit DDNVAGVTLPVFEHYHEGTDSYELTGLAR
A0402 Atp6v1dV-type proton ATPase subunit DFTAGDFSTTVIQNVNK
A0402 Atp6v1dV-type proton ATPase subunit DEAAFSLAEAK
A0402 Atp6v1dV-type proton ATPase subunit DMLMGEVMR
A0402 Atp6v1dV-type proton ATPase subunit DmLmGEVMREAAFSLAEAK
A0402 Atp6v1dV-type proton ATPase subunit DVNAIEHVIIPR
A0402 Atp6v1dV-type proton ATPase subunit DFTAGDFSTTVIQNVNK
A0403 Atp6v0d1V-type proton ATPase subunit d 1MVVEFR
A0403 Atp6v0d1V-type proton ATPase subunit d 1NVADYYPEYK
A0403 Atp6v0d1V-type proton ATPase subunit d 1SIAELVPK
A0403 Atp6v0d1V-type proton ATPase subunit d 1LHLQSTDYGNFLANEASPLTVSVIDDK
A0403 Atp6v0d1V-type proton ATPase subunit d 1LLFEGAGSNPGDK
A0403 Atp6v0d1V-type proton ATPase subunit d 1AFIITInSFGTELSKEDR
A0403 Atp6v0d1V-type proton ATPase subunit d 1AYLESFYK
A0403 Atp6v0d1V-type proton ATPase subunit d 1LYPEGLAQLAR
A0403 Atp6v0d1V-type proton ATPase subunit d 1NIVWIAEcIAQR
A0403 Atp6v0d1V-type proton ATPase subunit d 1FcTLLGGTTADAMcPILEFEADRR
A0412 Atp6ap2Renin receptorANSVFEDLSVTLR
A0412 Atp6ap2Renin receptorQENTQSPYNLAYK
A0415 Atp6v0a2V-type proton ATPase 116 kDa subunit a isoform 2KFVGEVK
A0415 Atp6v0a2V-type proton ATPase 116 kDa subunit a isoform 2HVLEmQEqLqK
A0415 Atp6v0a2V-type proton ATPase 116 kDa subunit a isoform 2LSqSqEILRmFFDGR
A0415 Atp6v0a2V-type proton ATPase 116 kDa subunit a isoform 2cLIAEVWcPEVDLPGLR
A0419 GsnGelsolinDGGQTAPASIR
A0419 GsnGelsolinTGAQELLK
A0419 GsnGelsolinSEDcFILDHGR
A0419 GsnGelsolinTPITVVR
A0419 GsnGelsolinYIETDPANRDR
A0419 GsnGelsolinKMDAHPPR
A0419 GsnGelsolinHVVPNEVVVQR
A0419 GsnGelsolinLFAcSNR
A0419 GsnGelsolinYIETDPANR
A0419 GsnGelsolinTASDFISK
A041A Gigyf1PERQ amino acid-rich with GYF domain-containing protein 1EPLRAqAPnHR
A042A Gigyf2PERQ amino acid-rich with GYF domain-containing protein 2QKDLmR
A042A Gigyf2PERQ amino acid-rich with GYF domain-containing protein 2LSGWGnVSKPAGTTK
A042A Gigyf2PERQ amino acid-rich with GYF domain-containing protein 2QKDLmR
A042A Gigyf2PERQ amino acid-rich with GYF domain-containing protein 2LSGWGnVSKPAGTTK
A042A Gigyf2PERQ amino acid-rich with GYF domain-containing protein 2QKDLmR
A042A Gigyf2PERQ amino acid-rich with GYF domain-containing protein 2LSGWGnVSKPAGTTK
A0430 Lmnb1Lamin-B1QLADETLLK
A0430 Lmnb1Lamin-B1QIEYEYK
A0430 Lmnb1Lamin-B1IGDTSVSYK
A0430 Lmnb1Lamin-B1LAVYIDK
A0430 Lmnb1Lamin-B1VTVSRASSSR
A0430 Lmnb1Lamin-B1IQELEDMLAK
A0430 Lmnb1Lamin-B1ALYETELADAR
A043C Kpnb1Importin subunit beta-1VLANPGNSQVAR
A043C Kpnb1Importin subunit beta-1AAVENLPTFLVELSR
A043C Kpnb1Importin subunit beta-1DcYPAVQK
A043C Kpnb1Importin subunit beta-1LLETTDRPDGHQNNLR
A043C Kpnb1Importin subunit beta-1KVQHQDALqISDVVmASLLR
A0442 Dpysl2Dihydropyrimidinase-related protein 2NLHQSGFSLSGAQIDDNIPR
A0442 Dpysl2Dihydropyrimidinase-related protein 2FQMPDQGMTSADDFFQGTK
A0442 Dpysl2Dihydropyrimidinase-related protein 2TSPAKqqAPPVR
A0442 Dpysl2Dihydropyrimidinase-related protein 2IVAPPGGR
A0442 Dpysl2Dihydropyrimidinase-related protein 2THNSALEYNIFEGMEcR
A0442 Dpysl2Dihydropyrimidinase-related protein 2MDENQFVAVTSTNAAK
A0442 Dpysl2Dihydropyrimidinase-related protein 2GIQEEMEALVK
A0442 Dpysl2Dihydropyrimidinase-related protein 2IVLEDGTLHVTEGSGR
A0442 Dpysl2Dihydropyrimidinase-related protein 2GLYDGPVcEVSVTPK
A0442 Dpysl2Dihydropyrimidinase-related protein 2ILDLGITGPEGHVLSRPEEVEAEAVNR
A0442 Dpysl2Dihydropyrimidinase-related protein 2ISVGSDADLVIWDPDSVK
A0448 Cdk1Cyclin-dependent kinase 1LADFGLAR
A0448 Cdk1Cyclin-dependent kinase 1LADFGLAR
A0459 PrphIsoform 5b of PeripherinNLQEAEEWYK
A0459 PrphIsoform 5b of PeripherinDGLAEDLAALK
A0459 PrphIsoform 5b of PeripherinNLQEAEEWYK
A0459 PrphIsoform 5b of PeripherinDGLAEDLAALK
A0462 DmdDystrophinVVEPqISELnR
A0462 DmdDystrophinWDnLTqKLEK
A0462 DmdDystrophinLLSKGqHLYK
A0462 DmdDystrophinLETELR
A0462 DmdDystrophinDAELIAEAKLLR
A0462 DmdDystrophinEDAmKnIQTSGFK
A0462 DmdDystrophinIEHYASR
A0462 DmdDystrophinGEIAPLKENVnR
A0462 DmdDystrophinVmVGDLEDInEmIIKQK
A0462 DmdDystrophinLEARMQILEDHNK
A0462 DmdDystrophinQKLLEqSIqSAqEIEK
A0462 DmdDystrophinmQILEDHnKqLESQLHR
A0462 DmdDystrophinVHmITEnINTSWGnIHK
A0462 DmdDystrophinVDAAQmPqEAQK
A0462 DmdDystrophinLQDVSmKFR
A0462 DmdDystrophinVVEPqISELnR
A0462 DmdDystrophinLETELR
A0462 DmdDystrophinEDAmKnIQTSGFK
A0462 DmdDystrophinQKLLEqSIqSAqEIEK
A0462 DmdDystrophinLQDVSmKFR
A0463 LckProto-oncogene tyrosine-protein kinase LCKIADFGLAR
A0475 Mapk13Mitogen-activated protein kinase 13EISnFSPIAR
A047C Ipo9Importin-9ISAVRAIWGYcDqLK
A047C Ipo9Importin-9ISAVRAIWGYcDqLK
A047C Ipo9Importin-9LLQHGINADDK
A047C Ipo9Importin-9LIInELSnVMEANAAR
A047C Ipo9Importin-9LLQHGINADDK
A047C Ipo9Importin-9LIInELSnVMEANAAR
A0480 Bcl2a1Bcl-2-related protein A1EVEKNLK
A0480 Bcl2a1Bcl-2-related protein A1EVEKNLK
A0492 Stip1Stress-induced-phosphoprotein 1ELIEQLQNKPSDLGTK
A0492 Stip1Stress-induced-phosphoprotein 1nPVIAQKIQK
A0492 Stip1Stress-induced-phosphoprotein 1LDPQNHVLYSNR
A0492 Stip1Stress-induced-phosphoprotein 1IGNSYFK
A0492 Stip1Stress-induced-phosphoprotein 1LILEQMQK
A0492 Stip1Stress-induced-phosphoprotein 1ELcEKAIEVGR
A0492 Stip1Stress-induced-phosphoprotein 1AAALEFLnR
A0492 Stip1Stress-induced-phosphoprotein 1LDPqnHVLYSNR
A0492 Stip1Stress-induced-phosphoprotein 1DPQALSEHLK
A0492 Stip1Stress-induced-phosphoprotein 1TYEEGLKHEANNLQLK
A0492 Stip1Stress-induced-phosphoprotein 1LAYINPDLALEEK
A0492 Stip1Stress-induced-phosphoprotein 1ALSAGNIDDALQcYSEAIK
A049C Jakmip1Janus kinase and microtubule-interacting protein 1qIEGTEAALTQKMmDLEK
A049C Jakmip1Janus kinase and microtubule-interacting protein 1FcQLTREYqALqR
A049C Jakmip1Janus kinase and microtubule-interacting protein 1qVLmRTNQDLLEK
A049C Jakmip1Janus kinase and microtubule-interacting protein 1EmEGKLELqR
A049C Jakmip1Janus kinase and microtubule-interacting protein 1KEALDQAYLK
A049C Jakmip1Janus kinase and microtubule-interacting protein 1IAELnSVIRK
A0501 Pacsin1Protein kinase C and casein kinase substrate in neurons protein 1HLnLAENSSYmHVYR
A0502 PtprmReceptor-type tyrosine-protein phosphatase muYRcmIcTEGGVGISNYAELVVK
A0502 PtprmReceptor-type tyrosine-protein phosphatase muTVVHcLNGGGR
A0502 PtprmReceptor-type tyrosine-protein phosphatase muVATKGAVTPKPVPEPEK
A0502 PtprmReceptor-type tyrosine-protein phosphatase muLWLqGIDVR
A0502 PtprmReceptor-type tyrosine-protein phosphatase muLLGEEEQSAASEK
A0502 PtprmReceptor-type tyrosine-protein phosphatase muYRcmIcTEGGVGISNYAELVVK
A0502 PtprmReceptor-type tyrosine-protein phosphatase muVATKGAVTPKPVPEPEK
A0502 PtprmReceptor-type tyrosine-protein phosphatase muLWLqGIDVR
A0503 Gabra1Gamma-aminobutyric acid receptor subunit alpha-1LnNLmASK
A0508 Atp2b2Plasma membrane calcium-transporting ATPase 2AKqQDGAAAMEmqPLK
A0508 Atp2b2Plasma membrane calcium-transporting ATPase 2MVTGDNINTAR
A0508 Atp2b2Plasma membrane calcium-transporting ATPase 2QVVAVTGDGTNDGPALK
A0508 Atp2b2Plasma membrane calcium-transporting ATPase 2GLNRIQTQIR
A0508 Atp2b2Plasma membrane calcium-transporting ATPase 2IqTqIR
A0508 Atp2b2Plasma membrane calcium-transporting ATPase 2DPmLLSGTHVMEGSGR
A0508 Atp2b2Plasma membrane calcium-transporting ATPase 2QqDGAAAMEMQPLK
A0508 Atp2b2Plasma membrane calcium-transporting ATPase 2AKqQDGAAAMEmqPLK
A0508 Atp2b2Plasma membrane calcium-transporting ATPase 2MYSKEHWAEPTQQR
A0508 Atp2b2Plasma membrane calcium-transporting ATPase 2VAWIFFSPK
A0508 Atp2b2Plasma membrane calcium-transporting ATPase 2DPmLLSGTHVMEGSGR
A0508 Atp2b2Plasma membrane calcium-transporting ATPase 2QqDGAAAMEMQPLK
A0512 MpdzMultiple PDZ domain proteinALqAAERLqSK
A051B SrrtSerrate RNA effector molecule homologEVAFFNNFLTDAK
A051I Rassf2Ras association domain-containing protein 2YMPKSELLLHLK
A0522 LynTyrosine-protein kinase LynIPYPGRTNADVMSALSQGYR
A0522 LynTyrosine-protein kinase LynIADFGLAR
A0530 Socs3Suppressor of cytokine signaling 3DSSDQRHFFTLSVK
A0535 DesDesminVELQELNDR
A0535 DesDesminEYQDLLNVK
A0539 Dock1Dedicator of cytokinesis protein 1DnRmScTVNVLnFYK
A0539 Dock1Dedicator of cytokinesis protein 1SQKQNMDINR
A0539 Dock1Dedicator of cytokinesis protein 1SnTNLLQQnLRQLmK
A0539 Dock1Dedicator of cytokinesis protein 1HRSSQDSK
A0539 Dock1Dedicator of cytokinesis protein 1NPDnEFAnMWIERTIYTTAYK
A0539 Dock1Dedicator of cytokinesis protein 1mEAcFKQLK
A0539 Dock1Dedicator of cytokinesis protein 1DGFqATTqGqLK
A0539 Dock1Dedicator of cytokinesis protein 1DnRmScTVNVLNFYK
A0539 Dock1Dedicator of cytokinesis protein 1DnRmScTVNVLnFYK
A0539 Dock1Dedicator of cytokinesis protein 1SQKQNMDINR
A0539 Dock1Dedicator of cytokinesis protein 1SnTNLLQQnLRQLmK
A0539 Dock1Dedicator of cytokinesis protein 1HRSSQDSK
A0539 Dock1Dedicator of cytokinesis protein 1NPDnEFAnMWIERTIYTTAYK
A0539 Dock1Dedicator of cytokinesis protein 1DGFqATTqGqLK
A0539 Dock1Dedicator of cytokinesis protein 1DnRmScTVNVLNFYK
A0540 Map3k2Mitogen-activated protein kinase kinase kinase 2GANILRDSTGNIK
A0545 Nckap1Nck-associated protein 1SLSELLGPYGMK
A0545 Nckap1Nck-associated protein 1GVGmLTRLYnIK
A0545 Nckap1Nck-associated protein 1EAAVSHAGSmHRER
A0545 Nckap1Nck-associated protein 1SLSELLGPYGMK
A0545 Nckap1Nck-associated protein 1GVGmLTRLYnIK
A0545 Nckap1Nck-associated protein 1EAAVSHAGSmHRER
A0545 Nckap1Nck-associated protein 1nNNqQLAQLQK
A054C Kif21aKinesin-like protein KIF21AITqLVSEqAnQVLAR
A054C Kif21aKinesin-like protein KIF21AITqLVSEqAnQVLAR
A054C Kif21aKinesin-like protein KIF21AmTISNMEADMnR
A054C Kif21aKinesin-like protein KIF21ATLTSSGqVTLGEAcSASTSR
A054C Kif21aKinesin-like protein KIF21AEGISINcGLLALGNVISALGDK
A054C Kif21aKinesin-like protein KIF21AITqLVSEqAnQVLAR
A054C Kif21aKinesin-like protein KIF21AITqLVSEqAnQVLAR
A054C Kif21aKinesin-like protein KIF21AmTISNMEADMnR
A054C Kif21aKinesin-like protein KIF21ATLTSSGqVTLGEAcSASTSR
A0553 Yes1Tyrosine-protein kinase YesGRVPYPGmVnR
A0553 Yes1Tyrosine-protein kinase YesLGQGcFGEVWMGTWnGTTKVAIK
A0553 Yes1Tyrosine-protein kinase YesDAERLLLnPGNQR
A0553 Yes1Tyrosine-protein kinase YesIADFGLAR
A0558 BrafSerine/threonine-protein kinase B-rafGDGAPLNQLmRcLR
A0558 BrafSerine/threonine-protein kinase B-rafGDGAPLNQLMR
A0558 BrafSerine/threonine-protein kinase B-rafmLNVTAPTPqQLqAFK
A055F Nlrp4eNACHT, LRR and PYD domains-containing protein 4EnGIMDSDISTLLDVR
A055F Nlrp4eNACHT, LRR and PYD domains-containing protein 4ETQEIFSLVR
A0560 Unc13aProtein unc-13 homolog ASKNNSWAPK
A0560 Unc13aProtein unc-13 homolog ALLDqLHnSLR
A0560 Unc13aProtein unc-13 homolog ATISNVLLQYADIVSK
A0560 Unc13aProtein unc-13 homolog ADFLHGALERDK
A0568 PcloProtein piccoloSPGVDPKqLAAELqK
A0568 PcloProtein piccoloAVLAqKPDK
A0568 PcloProtein piccoloQIAAVMSRAQGLPK
A0568 PcloProtein piccoloTnTmARAK
A0568 PcloProtein piccoloEGAqKALK
A0568 PcloProtein piccoloEEKqPK
A0568 PcloProtein piccoloDKDELR
A0568 PcloProtein piccoloIVNWHK
A0568 PcloProtein piccoloLEESEVTK
A0568 PcloProtein piccolocMDLSASAmDVKR
A0568 PcloProtein piccoloSPGVDPKqLAAELqK
A0568 PcloProtein piccoloSPGVDPKqLAAELqK
A0568 PcloProtein piccoloAVLAqKPDK
A0568 PcloProtein piccoloQIAAVMSRAQGLPK
A0568 PcloProtein piccoloTnTmARAK
A0568 PcloProtein piccoloEGAqKALK
A0568 PcloProtein piccoloEEKqPK
A0568 PcloProtein piccoloIVNWHK
A0568 PcloProtein piccoloLEESEVTK
A0568 PcloProtein piccolocMDLSASAmDVKR
A056C Kif26aKinesin-like protein KIF26AVmLRIWPAqGVqR
A056C Kif26aKinesin-like protein KIF26ATGTQSEQR
A056C Kif26aKinesin-like protein KIF26ALMVEPGR
A056C Kif26aKinesin-like protein KIF26AIWPAQGVqRSAESTSFLK
A0587 Add2Beta-adducinSRSPSTESqLMSK
A058C Kif12Kinesin-like protein KIF12RSSSHTLNQASSR
A058C Kif12Kinesin-like protein KIF12RSSSHTLNQASSR
A058D  UPF0704 protein C6orf165 homologELQPYmLK
A0596 NapaAlpha-soluble NSF attachment proteinHDAATcFVDAGNAFK
A0596 NapaAlpha-soluble NSF attachment proteinAIDIYEQVGTSAMDSPLLK
A0596 NapaAlpha-soluble NSF attachment proteinHDAATcFVDAGNAFKK
A0596 NapaAlpha-soluble NSF attachment proteinVAGYAAQLEQYQK
A0607 Pa2g4Proliferation-associated protein 2G4TIIQNPTDQQK
A0607 Pa2g4Proliferation-associated protein 2G4AFFSEVER
A0607 Pa2g4Proliferation-associated protein 2G4ITSGPFEPDLYK
A0607 Pa2g4Proliferation-associated protein 2G4MGGDIANR
A0607 Pa2g4Proliferation-associated protein 2G4SDQDYILK
A0607 Pa2g4Proliferation-associated protein 2G4TIIQNPTDQqKK
A0607 Pa2g4Proliferation-associated protein 2G4TIIQNPTDQQK
A0607 Pa2g4Proliferation-associated protein 2G4AFFSEVER
A0607 Pa2g4Proliferation-associated protein 2G4MGGDIANR
A0607 Pa2g4Proliferation-associated protein 2G4TIIQNPTDQqKK
A0615 Rabgef1Rab5 GDP/GTP exchange factorQmYKNLDLLSQLNER
A061G Dnaaf3Dynein assembly factor 3, axonemalADqIPPLEAmSPPQAK
A0625 Map1bMicrotubule-associated protein 1BTATAGPGTTKTAK
A0625 Map1bMicrotubule-associated protein 1BnAAnASASK
A0625 Map1bMicrotubule-associated protein 1BEEKEPK
A062B Surf6Surfeit locus protein 6VKGNLTPLTGR
A062C Kif1aKinesin-like protein KIF1AGILLQANSDK
A062C Kif1aKinesin-like protein KIF1AVISALAEMDSGPNKNK
A062C Kif1aKinesin-like protein KIF1AcNAIINEDPNNK
A062C Kif1aKinesin-like protein KIF1AGILLQANSDK
A0636 Dnajc5DnaJ homolog subfamily C member 5FKEINnAHAILTDATK
A0636 Dnajc5DnaJ homolog subfamily C member 5FKEINnAHAILTDATK
A0637 GphnGephyrinRGEcVLAK
A063G Dact2Dapper homolog 2LRMGFSqnK
A063G Dact2Dapper homolog 2QLPPqPERqR
A0645 ParvaAlpha-parvinLNVAEVTQSEIAQK
A0645 ParvaAlpha-parvinVLIDWINDVLVGER
A0645 ParvaAlpha-parvinQIQEEITGNTEALSGR
A0645 ParvaAlpha-parvinLQTVLEK
A0647 Anxa1Annexin A1HPnYSARF
A0656 Dctn2Dynactin subunit 2VGTKGLDFSDR
A0656 Dctn2Dynactin subunit 2LLGPDAAINLADPDGALAK
A0656 Dctn2Dynactin subunit 2QQLVASHLEK
A0656 Dctn2Dynactin subunit 2TGYESGDYEMLGEGLGVK
A0656 Dctn2Dynactin subunit 2ENLATVEGNFASIDAR
A0660 Actr1aAlpha-centractinAGFAGDQIPK
A0660 Actr1aAlpha-centractinLLSEVKK
A0660 Actr1aAlpha-centractinAQYYLPDGSTIEIGPSR
A0660 Actr1aAlpha-centractinAcYLSINPQKDETLETEK
A0662 Ank1Ankyrin-1AGHTEVAKYLLqnK
A0662 Ank1Ankyrin-1ELTAVPYMAK
A0662 Ank1Ankyrin-1AGHTEVAKYLLqnK
A0662 Ank1Ankyrin-1AGHTEVAKYLLqnK
A0662 Ank1Ankyrin-1ELTAVPYMAK
A0663 NfascNeurofascinDNILIEcEAK
A0663 NfascNeurofascinAAPTEVKIR
A0663 NfascNeurofascinDNILIEcEAK
A0667 Cdk5Cyclin-dependent kinase 5GLGFcHSR
A0667 Cdk5Cyclin-dependent kinase 5LADFGLAR
A0667 Cdk5Cyclin-dependent kinase 5EIcLLK
A0668 Ruvbl1RuvB-like 1TEVLmEnFR
A0668 Ruvbl1RuvB-like 1QAASGLVGQENAR
A0668 Ruvbl1RuvB-like 1TEVLmEnFR
A0684 Snap91Clathrin coat assembly protein AP180YLnEKAFSYR
A0684 Snap91Clathrin coat assembly protein AP180KGADGVmR
A0684 Snap91Clathrin coat assembly protein AP180NTLFNLSNFLDK
A0684 Snap91Clathrin coat assembly protein AP180NTLFnLSNFLDK
A0684 Snap91Clathrin coat assembly protein AP180YLnEKAFSYR
A0684 Snap91Clathrin coat assembly protein AP180KGADGVmR
A0684 Snap91Clathrin coat assembly protein AP180NTLFNLSNFLDK
A0684 Snap91Clathrin coat assembly protein AP180NTLFnLSNFLDK
A0687 Ap1g1AP-1 complex subunit gamma-1SSFREEDNTYR
A0687 Ap1g1AP-1 complex subunit gamma-1ADcASGIFLAAEK
A0688 Ap1m1AP-1 complex subunit mu-1mRVFLSGMPELR
A0688 Ap1m1AP-1 complex subunit mu-1YITQNGDYQLR
A0688 Ap1m1AP-1 complex subunit mu-1ILQEYITQEGHK
A0688 Ap1m1AP-1 complex subunit mu-1LGLNDKVLFDnTGR
A068I Rbm44RNA-binding protein 44RVEmIFDTLDnnSIGLGR
A068I Rbm44RNA-binding protein 44MQATAALETDSDK
A0696 Mapk8ip3C-Jun-amino-terminal kinase-interacting protein 3GQLLGLRAnK
A0696 Mapk8ip3C-Jun-amino-terminal kinase-interacting protein 3GQLLGLRAnK
A070A Mup21Major urinary protein 26LcEEHGIIREnIIDLTNVNR
A0711 TecTyrosine-protein kinase TecTEDKEGGFMVR
A0711 TecTyrosine-protein kinase TecNNnNIMIKYHPK
A0711 TecTyrosine-protein kinase TecLERGqEYIILEK
A0716 Xrcc6X-ray repair cross-complementing protein 6mKAIVqK
A071J Ublcp1Ubiquitin-like domain-containing CTD phosphatase 1FSEFYSK
A0720 Stat5aSignal transducer and activator of transcription 5AVPFAVPDKVLWPQLcEALNMK
A0720 Stat5aSignal transducer and activator of transcription 5ANmSLKR
A0720 Stat5aSignal transducer and activator of transcription 5AKAEHqVGEDGFLLK
A0720 Stat5aSignal transducer and activator of transcription 5ALNVHmnPPqVK
A0720 Stat5aSignal transducer and activator of transcription 5ALITQDTENELK
A0720 Stat5aSignal transducer and activator of transcription 5AFTVLFESQFSVGSnELVFQVK
A0720 Stat5aSignal transducer and activator of transcription 5AVLWPqLcEALNmK
A0720 Stat5aSignal transducer and activator of transcription 5AVPFAVPDKVLWPQLcEALNMK
A0720 Stat5aSignal transducer and activator of transcription 5ANmSLKR
A0720 Stat5aSignal transducer and activator of transcription 5AKAEHqVGEDGFLLK
A0720 Stat5aSignal transducer and activator of transcription 5ALNVHmnPPqVK
A0720 Stat5aSignal transducer and activator of transcription 5ALITQDTENELK
A0720 Stat5aSignal transducer and activator of transcription 5AFTVLFESQFSVGSnELVFQVK
A0720 Stat5aSignal transducer and activator of transcription 5AVLWPqLcEALNmK
A072I Rnf7RING-box protein 2SGGDKmFSLK
A072I Rnf7RING-box protein 2VqmPAFDVK
A0735 Drd5D(1B) dopamine receptorIYRIAqVqIR
A0739 TrioTriple functional domain proteinDcAEKVASHWqQLmLK
A0739 TrioTriple functional domain proteinTSEQVcSVLESLEQEYK
A0739 TrioTriple functional domain proteinEGEDLIQQLRDSAISSNK
A0739 TrioTriple functional domain proteinMKVMESPR
A0739 TrioTriple functional domain proteinqqELDLAAEQHR
A0739 TrioTriple functional domain proteinNSGSGNADLQnLLPK
A0739 TrioTriple functional domain proteinKGFSMPGFLFK
A0739 TrioTriple functional domain proteinnFLqSR
A0739 TrioTriple functional domain proteinAPEQQVKNILnELFqR
A0739 TrioTriple functional domain proteinEFImAELIqTEKAYVR
A073C Kif9Kinesin-like protein KIF9GLmIIDEEEFLLILKLK
A0740 ArAndrogen receptorFYQLTK
A0740 ArAndrogen receptorSFTNVNSR
A074C Kifc1Kinesin-like protein KIFC1DLLATGPR
A074C Kifc1Kinesin-like protein KIFC1DLLATGPR
A074C Kifc1Kinesin-like protein KIFC1mDVQAqRPPLLEVK
A0763 Kcna1Potassium voltage-gated channel subfamily A member 1TLAQFPnTLLGnPKK
A0766 Epha7Ephrin type-A receptor 7KIMSSIqTmR
A0779 Anp32aAcidic leucine-rich nuclear phosphoprotein 32 family member AELVLDNcK
A0779 Anp32aAcidic leucine-rich nuclear phosphoprotein 32 family member AHLNLSGNK
A0779 Anp32aAcidic leucine-rich nuclear phosphoprotein 32 family member AIYLELR
A0779 Anp32aAcidic leucine-rich nuclear phosphoprotein 32 family member AISGDLEVLAEK
A0779 Anp32aAcidic leucine-rich nuclear phosphoprotein 32 family member ASLDLFNcEVTNLNAYR
A0779 Anp32aAcidic leucine-rich nuclear phosphoprotein 32 family member AELVLDNcK
A0779 Anp32aAcidic leucine-rich nuclear phosphoprotein 32 family member AHLNLSGNK
A0779 Anp32aAcidic leucine-rich nuclear phosphoprotein 32 family member AISGDLEVLAEK
A0779 Anp32aAcidic leucine-rich nuclear phosphoprotein 32 family member ASLDLFNcEVTNLNAYR
A0779 Anp32aAcidic leucine-rich nuclear phosphoprotein 32 family member AELVLDNcK
A0779 Anp32aAcidic leucine-rich nuclear phosphoprotein 32 family member AISGDLEVLAEK
A0779 Anp32aAcidic leucine-rich nuclear phosphoprotein 32 family member ASLDLFNcEVTNLNAYR
A0784 Dync1li1Cytoplasmic dynein 1 light intermediate chain 1EImAEDDqVFLMK
A0784 Dync1li1Cytoplasmic dynein 1 light intermediate chain 1NVLLLGEDGAGK
A0784 Dync1li1Cytoplasmic dynein 1 light intermediate chain 1KPASVSPTTPTSPTEGEAS
A0784 Dync1li1Cytoplasmic dynein 1 light intermediate chain 1DTLVmLVVDmSKPWTALDSLqK
A0787 Fkbp4Peptidyl-prolyl cis-trans isomerase FKBP4RGEAHLAVNDFDLAR
A0787 Fkbp4Peptidyl-prolyl cis-trans isomerase FKBP4VLQLYPSNK
A0787 Fkbp4Peptidyl-prolyl cis-trans isomerase FKBP4VGEVcHITcKPEYAYGAAGSPPK
A0787 Fkbp4Peptidyl-prolyl cis-trans isomerase FKBP4EGTGTETPMIGDR
A0787 Fkbp4Peptidyl-prolyl cis-trans isomerase FKBP4ALELDSNNEK
A0787 Fkbp4Peptidyl-prolyl cis-trans isomerase FKBP4LEQSNIVK
A0787 Fkbp4Peptidyl-prolyl cis-trans isomerase FKBP4LYANMFER
A0787 Fkbp4Peptidyl-prolyl cis-trans isomerase FKBP4LQAFSAAIEScNK
A0787 Fkbp4Peptidyl-prolyl cis-trans isomerase FKBP4TQLAVcQQR
A0787 Fkbp4Peptidyl-prolyl cis-trans isomerase FKBP4FSFDLGK
A078A RalbRas-related protein Ral-BVIMVGSGGVGK
A078A RalbRas-related protein Ral-BSALTLQFMYDEFVEDYEPTK
A078A RalbRas-related protein Ral-BGKAEEWGVQYVETSAK
A078A RalbRas-related protein Ral-BGKAEEWGVQYVETSAK
A0792 Pan2PAB-dependent poly(A)-specific ribonuclease subunit 2LIQRWNR
A0792 Pan2PAB-dependent poly(A)-specific ribonuclease subunit 2IqGETHDSIEDAR
A0792 Pan2PAB-dependent poly(A)-specific ribonuclease subunit 2LIQRWnR
A0792 Pan2PAB-dependent poly(A)-specific ribonuclease subunit 2LIQRWNR
A0792 Pan2PAB-dependent poly(A)-specific ribonuclease subunit 2IqGETHDSIEDAR
A0792 Pan2PAB-dependent poly(A)-specific ribonuclease subunit 2LIQRWnR
A0795 MYBTranscriptional activator MybVEQEGYLqEPSK
A0795 MYBTranscriptional activator MybVLSEASLGPDSPqAR
A0795 MYBTranscriptional activator MybmLPqTPSHAVEDLqDVIK
A0795 MYBTranscriptional activator MybMLPQTPSHAVEDLqDVIK
A0795 MYBTranscriptional activator MybMLPQTPSHAVEDLqDVIK
A0795 MYBTranscriptional activator MybVEQEGYLqEPSK
A0795 MYBTranscriptional activator MybmLPqTPSHAVEDLqDVIK
A0795 MYBTranscriptional activator MybMLPQTPSHAVEDLqDVIK
A0796 Akap2A-kinase anchor protein 2AKnAPSLPSR
A0796 Akap2A-kinase anchor protein 2LWAEDGEFTSARAVLTVVK
A0796 Akap2A-kinase anchor protein 2ELIRSqAVK
A0796 Akap2A-kinase anchor protein 2AVLTVVKDEDHGILDQFSR
A0796 Akap2A-kinase anchor protein 2YSEAAELR
A0796 Akap2A-kinase anchor protein 2SVPGVTSTPHSK
A0796 Akap2A-kinase anchor protein 2AEAHTSKER
A0796 Akap2A-kinase anchor protein 2AKnAPSLPSR
A0796 Akap2A-kinase anchor protein 2LWAEDGEFTSARAVLTVVK
A0796 Akap2A-kinase anchor protein 2ELIRSqAVK
A0796 Akap2A-kinase anchor protein 2AVLTVVKDEDHGILDQFSR
A0796 Akap2A-kinase anchor protein 2YSEAAELR
A0796 Akap2A-kinase anchor protein 2qSTPSPR
A0796 Akap2A-kinase anchor protein 2SVPGVTSTPHSK
A0796 Akap2A-kinase anchor protein 2AKnAPSLPSR
A0796 Akap2A-kinase anchor protein 2LWAEDGEFTSARAVLTVVK
A0796 Akap2A-kinase anchor protein 2AVLTVVKDEDHGILDQFSR
A0796 Akap2A-kinase anchor protein 2YSEAAELR
A0796 Akap2A-kinase anchor protein 2qSTPSPR
A0796 Akap2A-kinase anchor protein 2AKnAPSLPSR
A0796 Akap2A-kinase anchor protein 2ELIRSqAVK
A0796 Akap2A-kinase anchor protein 2AVLTVVKDEDHGILDQFSR
A0796 Akap2A-kinase anchor protein 2YSEAAELR
A0796 Akap2A-kinase anchor protein 2SVPGVTSTPHSK
A079C Klc4Kinesin light chain 4GQGAAAAQQGGYEIPAR
A079C Klc4Kinesin light chain 4GQGAAAAQQGGYEIPAR
A0801 Akap4A-kinase anchor protein 4 precursorVDLYSPK
A0801 Akap4A-kinase anchor protein 4 precursornqSLEFSAmK
A0801 Akap4A-kinase anchor protein 4 precursorSKqAAPVAK
A0801 Akap4A-kinase anchor protein 4 precursornqSLEFSAmK
A0813 Adrbk1Beta-adrenergic receptor kinase 1ADTGKMYAMK
A0813 Adrbk1Beta-adrenergic receptor kinase 1ADTGKMYAMK
A0816 EnahProtein enabled homologGNGPLPLGGSGLMEEMSALLAR
A0816 EnahProtein enabled homologGNGPLPLGGSGLMEEMSALLAR
A082F ThrbThyroid hormone receptor betaAAVRYDPDSETLTLNGEMAVTR
A0830 Trpc4Short transient receptor potential channel 4qFAKDLLDqTR
A0830 Trpc4Short transient receptor potential channel 4qDISSFRFEVLGLLR
A0830 Trpc4Short transient receptor potential channel 4qFAKDLLDqTR
A0830 Trpc4Short transient receptor potential channel 4qDISSFRFEVLGLLR
A0832 Tbc1d10aTBC1 domain family member 10AWLDMLNnWDK
A0832 Tbc1d10aTBC1 domain family member 10AWQETRGELEcR
A0832 Tbc1d10aTBC1 domain family member 10AGGHGqqDLFRVLK
A0832 Tbc1d10aTBC1 domain family member 10AVKLqqnPGK
A0836 HgsHepatocyte growth factor-regulated tyrosine kinase substrateRQVEVNVR
A0836 HgsHepatocyte growth factor-regulated tyrosine kinase substrateqTMEELKELLK
A0836 HgsHepatocyte growth factor-regulated tyrosine kinase substrateYAVNSIK
A0836 HgsHepatocyte growth factor-regulated tyrosine kinase substrateVqFGVVTR
A0836 HgsHepatocyte growth factor-regulated tyrosine kinase substrateAcGqIFcGKcSSK
A0837 Icam2Intercellular adhesion molecule 2KLTSLTPR
A083D  UPF0598 protein C8orf82 homologVSYTQGqSPEPRTR
A083D  UPF0598 protein C8orf82 homolognLALVLAR
A083D  UPF0598 protein C8orf82 homologLSYcGGGEALAIPFEPAR
A083D  UPF0598 protein C8orf82 homologVSYTQGQSPEPR
A083D  UPF0598 protein C8orf82 homologVSYTQGqSPEPRTR
A083D  UPF0598 protein C8orf82 homolognLALVLAR
A083D  UPF0598 protein C8orf82 homologVSYTQGQSPEPR
A083J Usp22Ubiquitin carboxyl-terminal hydrolase 22KITSncTIGLR
A083J Usp22Ubiquitin carboxyl-terminal hydrolase 22KITSncTIGLR
A084J Usp25Ubiquitin carboxyl-terminal hydrolase 25DSFGGYRNASAYcLmYIDDK
A084J Usp25Ubiquitin carboxyl-terminal hydrolase 25LPSYSAHELcER
A084J Usp25Ubiquitin carboxyl-terminal hydrolase 25mTVEqNVLqqSAAQK
A084J Usp25Ubiquitin carboxyl-terminal hydrolase 25LLDWLEDAFQmK
A084J Usp25Ubiquitin carboxyl-terminal hydrolase 25YNDIAVTK
A0850 VimVimentinLQEEmLQR
A0850 VimVimentinqVDQLTNDKAR
A0850 VimVimentinNLQEAEEWYK
A0850 VimVimentinQVQSLTcEVDALK
A0850 VimVimentinQQYESVAAK
A0850 VimVimentinLQEEMLQR
A0850 VimVimentinSYVTTSTR
A0850 VimVimentinLGDLYEEEMR
A0850 VimVimentinVELQELNDR
A0850 VimVimentinEEAESTLQSFR
A0850 VimVimentinLqEEmLQR
A0850 VimVimentinQDVDNASLAR
A0850 VimVimentinFADLSEAANR
A0850 VimVimentinEYQDLLNVK
A0850 VimVimentinILLAELEQLK
A0850 VimVimentinILLAELEqLKGqGK
A0854 PawrIsoform 2 of PRKC apoptosis WT1 regulator proteinqnPAGPGSSGGDPAAK
A085C Slc7a8Large neutral amino acids transporter small subunit 2SLTLVSQK
A085C Slc7a8Large neutral amino acids transporter small subunit 2NHPGSDTSPEAEASSGGGGVALK
A085C Slc7a8Large neutral amino acids transporter small subunit 2QRNNTAK
A085C Slc7a8Large neutral amino acids transporter small subunit 2EGHLPSVLAMIHVK
A085C Slc7a8Large neutral amino acids transporter small subunit 2NHPGSDTSPEAEASSGGGGVALKK
A0861 Traf1TNF receptor-associated factor 1NKVTFmLLDQNNR
A0861 Traf1TNF receptor-associated factor 1APccESQEELALQHLVK
A0867 Birc3Baculoviral IAP repeat-containing protein 3NSLREIDPALYR
A0867 Birc3Baculoviral IAP repeat-containing protein 3NSLREIDPALYR
A086A Reps1RalBP1-associated Eps domain-containing protein 1mTPSKIHmqEMELK
A086A Reps1RalBP1-associated Eps domain-containing protein 1LNSELqqqLK
A086J Usp29Ubiquitin carboxyl-terminal hydrolase 29SISTVADTFSGnEqnDAHEFLSLcLDQLKLnMEK
A086J Usp29Ubiquitin carboxyl-terminal hydrolase 29INGLVQIR
A086J Usp29Ubiquitin carboxyl-terminal hydrolase 29mPLSMSNTTGGQKR
A086J Usp29Ubiquitin carboxyl-terminal hydrolase 29MAHLKINGLVQIR
A0877 Tnfrsf1aTumor necrosis factor receptor superfamily member 1AEFmRFmGLSEHEIER
A087C Slc43a2Large neutral amino acids transporter small subunit 4QVTTVGR
A087C Slc43a2Large neutral amino acids transporter small subunit 4LSVGSSMR
A087C Slc43a2Large neutral amino acids transporter small subunit 4LcLSTVDLEVK
A0883 Irs2Insulin receptor substrate 2VASPTSGLK
A0883 Irs2Insulin receptor substrate 2ETSVGFqnGLnYIAIDVR
A0894 Fgfr1Fibroblast growth factor receptor 1DcWHAVPSQRPTFK
A0894 Fgfr1Fibroblast growth factor receptor 1IADFGLAR
A0904 GrapGRB2-related adapter proteinGDTLKILnmEDDqnWYK
A090D Chchd2Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrialQFLEcAQNQSDVK
A090D Chchd2Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrialLcEGFNEVLR
A090D Chchd2Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrialAPqmRAAPqR
A090D Chchd2Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrialQFLEcAQNQSDVK
A090D Chchd2Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrialLcEGFNEVLR
A091H Rps6ka5Ribosomal protein S6 kinase alpha-5KATIVqK
A091H Rps6ka5Ribosomal protein S6 kinase alpha-5LLMKDPK
A091H Rps6ka5Ribosomal protein S6 kinase alpha-5mEAnTqKEITALK
A0921 Ncor1Nuclear receptor corepressor 1LEPVSDAHFQR
A0921 Ncor1Nuclear receptor corepressor 1SAAVSEqQQLEQK
A0921 Ncor1Nuclear receptor corepressor 1SQNSQPEGLLVR
A0921 Ncor1Nuclear receptor corepressor 1KQEIFR
A0921 Ncor1Nuclear receptor corepressor 1LEPVSDAHFQR
A0921 Ncor1Nuclear receptor corepressor 1SAAVSEqQQLEQK
A0921 Ncor1Nuclear receptor corepressor 1EELIqSMDR
A0921 Ncor1Nuclear receptor corepressor 1THRLITLADHIcqIITQDFAR
A0921 Ncor1Nuclear receptor corepressor 1qLSPTPGYPSQYqLYAMENTR
A0921 Ncor1Nuclear receptor corepressor 1SQNSQPEGLLVR
A0921 Ncor1Nuclear receptor corepressor 1KQEIFR
A0921 Ncor1Nuclear receptor corepressor 1SAAVSEqQQLEQK
A0921 Ncor1Nuclear receptor corepressor 1EELIqSMDR
A0921 Ncor1Nuclear receptor corepressor 1SQNSQPEGLLVR
A0921 Ncor1Nuclear receptor corepressor 1KQEIFR
A0921 Ncor1Nuclear receptor corepressor 1ESPPIRAFEGAIT
A0921 Ncor1Nuclear receptor corepressor 1SPNREWEGK
A0921 Ncor1Nuclear receptor corepressor 1RALEQEAHmHSTAAR
A0921 Ncor1Nuclear receptor corepressor 1SQNSQPEGLLVR
A0924 Top2aDNA topoisomerase 2-alphaqIMEnAEINNIIK
A0924 Top2aDNA topoisomerase 2-alphaNSTEcTLILTEGDSAK
A0924 Top2aDNA topoisomerase 2-alphaDIVALMVR
A0924 Top2aDNA topoisomerase 2-alphaVTGGRnGYGAK
A0924 Top2aDNA topoisomerase 2-alphaDIVALmVRR
A0924 Top2aDNA topoisomerase 2-alphaVIHEQVnPR
A092C Lman1Protein ERGIC-53DIDSLAQR
A092C Lman1Protein ERGIC-53KEEFqK
A092C Lman1Protein ERGIC-53IHLEIKqLNR
A092I Rab11fip4Rab11 family-interacting protein 4mSDRLEDTSLR
A092I Rab11fip4Rab11 family-interacting protein 4VTELENDSLTSGGLK
A092I Rab11fip4Rab11 family-interacting protein 4QENMQLVHR
A092I Rab11fip4Rab11 family-interacting protein 4LKSqTEK
A092I Rab11fip4Rab11 family-interacting protein 4MRSPPAPGcQGSDFSGSTDGEQLPR
A0930 Cdk2Cyclin-dependent kinase 2LADFGLAR
A0933 Nr3c1Glucocorticoid receptorFYQLTK
A093C Lman2Vesicular integral-membrane protein VIP36NcIDITGVR
A093C Lman2Vesicular integral-membrane protein VIP36LPTGYYFGASAGTGDLSDNHDIISIK
A093C Lman2Vesicular integral-membrane protein VIP36REHSLIKPYQGVGSSSMPLWDFqGSTMLTSqYVR
A093C Lman2Vesicular integral-membrane protein VIP36REHSLIKPYQGVGSSSMPLWDFqGSTMLTSqYVR
A093I Rfpl4aRet finger protein-like 4AKAIHLSEK
A0940 Prkd1Serine/threonine-protein kinase D1RLSnVSLTGLGTVR
A0940 Prkd1Serine/threonine-protein kinase D1LSNVSLTGLGTVR
A0940 Prkd1Serine/threonine-protein kinase D1MWEVAIqHALMPVIPK
A0943 PhipPH-interacting proteinSILLDMATRPAGQnLqGIEDK
A0944 Ncf2Neutrophil cytosol factor 2LALSPEHTKLSYR
A0944 Ncf2Neutrophil cytosol factor 2TPEIFR
A0944 Ncf2Neutrophil cytosol factor 2DLKEALTQLR
A0944 Ncf2Neutrophil cytosol factor 2QTTEPQPK
A0944 Ncf2Neutrophil cytosol factor 2nLEGIPR
A0949 Jak3Tyrosine-protein kinase JAK3LPVGLSMK
A0949 Jak3Tyrosine-protein kinase JAK3LPVGLSMK
A0954 Il4rInterleukin-4 receptor subunit alphaLSFPInILMSGVYYTAR
A0954 Il4rInterleukin-4 receptor subunit alphaLSFPInILMSGVYYTAR
A095D Chid1Chitinase domain-containing protein 1FTqISPVWLQLKR
A095D Chid1Chitinase domain-containing protein 1FTqISPVWLQLKR
A095D Chid1Chitinase domain-containing protein 1EFEQLAPILDGFSLmTYDY
A096A RhogRho-related GTP-binding protein RhoGcVVVGDGAVGK
A096A RhogRho-related GTP-binding protein RhoGMQSIKcVVVGDGAVGK
A0973 Eif4eEukaryotic translation initiation factor 4EIAIWTTEcENR
A0973 Eif4eEukaryotic translation initiation factor 4ESKTWqANLR
A0977 Ppp1r3aProtein phosphatase 1 regulatory subunit 3ADDLGANHPNVDDINK
A0977 Ppp1r3aProtein phosphatase 1 regulatory subunit 3AQIKGcLK
A0977 Ppp1r3aProtein phosphatase 1 regulatory subunit 3ATDNSRnLK
A0978 PyglGlycogen phosphorylase, liver formVLYPNDNFFEGK
A0978 PyglGlycogen phosphorylase, liver formKFFVPR
A0978 PyglGlycogen phosphorylase, liver formNLAENISR
A097B Tdrd6Tudor domain-containing protein 6LGLLGYK
A097B Tdrd6Tudor domain-containing protein 6cAqVLHVDYGR
A097B Tdrd6Tudor domain-containing protein 6LGLLGYK
A097B Tdrd6Tudor domain-containing protein 6EDIFASSPMSGTK
A097B Tdrd6Tudor domain-containing protein 6FqEFETK
A097B Tdrd6Tudor domain-containing protein 6EEEAcGGDADSLSTAK
A097B Tdrd6Tudor domain-containing protein 6cAqVLHVDYGR
A097B Tdrd6Tudor domain-containing protein 6EEYVRLSR
A097B Tdrd6Tudor domain-containing protein 6LGLLGYK
A097B Tdrd6Tudor domain-containing protein 6FqEFETK
A097J UbqlnlUbiquilin-like proteinGNSSmVcQSAGmNETK
A0988 Csf2raGranulocyte-macrophage colony-stimulating factor receptor subunit alphaDHLLNLTLInMInRIK
A098A RictorRapamycin-insensitive companion of mTOREDLLSPInHNTLQR
A098A RictorRapamycin-insensitive companion of mTORIRSqSFnTDTTTSGISSMSSSPSR
A098A RictorRapamycin-insensitive companion of mTORLGHLnnFTK
A098A RictorRapamycin-insensitive companion of mTOREILQNVAK
A098A RictorRapamycin-insensitive companion of mTORQGcDILKcHSWDSVR
A098A RictorRapamycin-insensitive companion of mTOREDLLSPInHNTLQR
A098A RictorRapamycin-insensitive companion of mTORQGcDILKcHSWDSVR
A098H KyKyphoscoliosis peptidaseSMPLDLR
A098H KyKyphoscoliosis peptidaseGGFQGVRNGIR
A098H KyKyphoscoliosis peptidaseTQKTNcDGYAGLFER
A098H KyKyphoscoliosis peptidaseSMPLDLR
A098J Ubr3E3 ubiquitin-protein ligase UBR3DLLMMSEFVLPR
A098J Ubr3E3 ubiquitin-protein ligase UBR3DLLMMSEFVLPR
A0990 Ppm1aProtein phosphatase 1AIQNAGGSVMIQR
A0990 Ppm1aProtein phosphatase 1AIQNAGGSVMIQR
A0992 HckTyrosine-protein kinase HCKIADFGLAR
A1004 Ppp1r12aProtein phosphatase 1 regulatory subunit 12ALYEQILAENEKLK
A1018 Diaph1Protein diaphanous homolog 1MADELERFTSmR
A1018 Diaph1Protein diaphanous homolog 1DAqEqYnKLR
A1018 Diaph1Protein diaphanous homolog 1LMADELER
A1018 Diaph1Protein diaphanous homolog 1DAqEqYnKLR
A1018 Diaph1Protein diaphanous homolog 1DAqEqYnKLR
A1023 LppLipoma-preferred partner homologSEGDTAYGQQVQPNTWK
A1023 LppLipoma-preferred partner homologSTGEPLGHVPAR
A1023 LppLipoma-preferred partner homologcSVcKEPIMPAPGQEETVR
A1023 LppLipoma-preferred partner homologcEDcGGLLSEGDNQGcYPLDGHILcK
A1023 LppLipoma-preferred partner homologYYEPYYAAGPSYGGR
A1023 LppLipoma-preferred partner homologMLYDMENPPADDYFGR
A1023 LppLipoma-preferred partner homologGQPFYAVEK
A1023 LppLipoma-preferred partner homologTYITDPVSAPcAPPLQPK
A1023 LppLipoma-preferred partner homologAYcEPcYINTLEQcSVcSKPIMER
A1026 Sema6aSemaphorin-6AKTcIASR
A1026 Sema6aSemaphorin-6ALATPSNTAKMLIK
A102A Rras2Ras-related protein R-Ras2LVVVGGGGVGK
A102A Rras2Ras-related protein R-Ras2QVTQEEGQQLAR
A102A Rras2Ras-related protein R-Ras2DGSGQEKYR
A102A Rras2Ras-related protein R-Ras2LDILDTAGQEEFGAMR
A102J Ubxn2bUBX domain-containing protein 2BGSSRPRPPSAR
A103H TmpoLamina-associated polypeptide 2, isoforms beta/delta/epsilon/gammaSELVANNVTLPAGEQR
A103H TmpoLamina-associated polypeptide 2, isoforms beta/delta/epsilon/gammaEMFPYEASTPTGISAScR
A103H TmpoLamina-associated polypeptide 2, isoforms beta/delta/epsilon/gammaSELVANNVTLPAGEQR
A103H TmpoLamina-associated polypeptide 2, isoforms beta/delta/epsilon/gammaEMFPYEASTPTGISAScR
A103H TmpoLamina-associated polypeptide 2, isoforms beta/delta/epsilon/gammaYAPLADVK
A103H TmpoLamina-associated polypeptide 2, isoforms beta/delta/epsilon/gammaSELVANNVTLPAGEQR
A103H TmpoLamina-associated polypeptide 2, isoforms beta/delta/epsilon/gammaEMFPYEASTPTGISAScR
A103H TmpoLamina-associated polypeptide 2, isoforms beta/delta/epsilon/gammaYAPLADVK
A103H TmpoLamina-associated polypeptide 2, isoforms beta/delta/epsilon/gammaSELVANNVTLPAGEQR
A103H TmpoLamina-associated polypeptide 2, isoforms beta/delta/epsilon/gammaEMFPYEASTPTGISAScR
A103H TmpoLamina-associated polypeptide 2, isoforms beta/delta/epsilon/gammaYAPLADVK
A1043 Dis3Exosome complex exonuclease RRP44HPAPPPSNYDILVK
A104B Gtf2h2General transcription factor IIH subunit 2AEKLTELSGnPR
A104B Gtf2h2General transcription factor IIH subunit 2LTELSGNPR
A1053 Sin3bPaired amphipathic helix protein Sin3bNEEKSLEHNK
A1053 Sin3bPaired amphipathic helix protein Sin3bqMSYKEDR
A1053 Sin3bPaired amphipathic helix protein Sin3bLVqnIAR
A1053 Sin3bPaired amphipathic helix protein Sin3bRIGSSYR
A1053 Sin3bPaired amphipathic helix protein Sin3bVLESVqKK
A1053 Sin3bPaired amphipathic helix protein Sin3bNEEKSLEHNK
A1053 Sin3bPaired amphipathic helix protein Sin3bqMSYKEDR
A1053 Sin3bPaired amphipathic helix protein Sin3bLVqnIAR
A1053 Sin3bPaired amphipathic helix protein Sin3bRIGSSYR
A1053 Sin3bPaired amphipathic helix protein Sin3bVLESVqKK
A1057 Rbbp4Histone-binding protein RBBP4HPSKPDPSGEcNPDLR
A105B Brf1Transcription factor IIIB 90 kDa subunitRPSGLcGAALLVAAR
A105B Brf1Transcription factor IIIB 90 kDa subunitESRAqTLQNGR
A105B Brf1Transcription factor IIIB 90 kDa subunitEcISSPSGDPK
A105B Brf1Transcription factor IIIB 90 kDa subunitYILNESEAR
A105B Brf1Transcription factor IIIB 90 kDa subunitmKqLEQVLSK
A1061 FerTyrosine-protein kinase FerMqEEmIKALK
A1061 FerTyrosine-protein kinase FermqEEmIKALK
A1061 FerTyrosine-protein kinase FerIEAqELLK
A1061 FerTyrosine-protein kinase FerMqEEmIKALK
A1061 FerTyrosine-protein kinase FermqEEmIKALK
A1061 FerTyrosine-protein kinase FerIEAqELLK
A1061 FerTyrosine-protein kinase FerLTmmIK
A1061 FerTyrosine-protein kinase FermqEEmIKALK
A1061 FerTyrosine-protein kinase FerIEAqELLK
A1061 FerTyrosine-protein kinase FerLTmmIK
A1067 Arhgef12Rho guanine nucleotide exchange factor 12LQLLQEDYNR
A1069 NgefEphexin-1MEDPqRSQnK
A1069 NgefEphexin-1QLLqEK
A1069 NgefEphexin-1MEDPqRSQnK
A1069 NgefEphexin-1QLLqEK
A1069 NgefEphexin-1TEDGWIFGER
A1069 NgefEphexin-1MEDPqRSQnK
A1069 NgefEphexin-1QLLqEK
A1069 NgefEphexin-1TEDGWIFGER
A106A Rsu1Ras suppressor protein 1KPLAAKnK
A106A Rsu1Ras suppressor protein 1HMQANPEPPKK
A106A Rsu1Ras suppressor protein 1ALYLSDNDFEILPPDIGK
A106A Rsu1Ras suppressor protein 1KPLAAKnK
A106A Rsu1Ras suppressor protein 1DNDLISLPK
A106A Rsu1Ras suppressor protein 1GISSMLDVNGLSVPPnVAELK
A106A Rsu1Ras suppressor protein 1HMQANPEPPKK
A106A Rsu1Ras suppressor protein 1ALYLSDNDFEILPPDIGK
A106B Gtf3c1General transcription factor 3C polypeptide 1LIIVASQDmR
A106B Gtf3c1General transcription factor 3C polypeptide 1LRVSWSmQEDGLLmLcR
A106B Gtf3c1General transcription factor 3C polypeptide 1cPcAQKIcPDPGSDPEGSLR
A106B Gtf3c1General transcription factor 3C polypeptide 1nLSEEGLLR
A106B Gtf3c1General transcription factor 3C polypeptide 1VDLVVHPSmDqnDPLVRSAIEQVR
A106B Gtf3c1General transcription factor 3C polypeptide 1IASNVLNTK
A1072 NrcamNeuronal cell adhesion moleculeLLHDLVqPPTITqQSPK
A1072 NrcamNeuronal cell adhesion moleculeENIVIqcEAK
A1072 NrcamNeuronal cell adhesion moleculeENIVIqcEAK
A1080 Col18a1Collagen alpha-1(XVIII) chainEENVAGVGAK
A1080 Col18a1Collagen alpha-1(XVIII) chainSVWHGSDPSGR
A1080 Col18a1Collagen alpha-1(XVIII) chainADDILANPPRLPDR
A1080 Col18a1Collagen alpha-1(XVIII) chainGADFQcFQQAR
A1080 Col18a1Collagen alpha-1(XVIII) chainGEQGLPGPKGEK
A1080 Col18a1Collagen alpha-1(XVIII) chainADDILANPPR
A1080 Col18a1Collagen alpha-1(XVIII) chainADDILAnPPR
A1080 Col18a1Collagen alpha-1(XVIII) chainSVWHGSDPSGR
A1080 Col18a1Collagen alpha-1(XVIII) chainLQDLYSIVRR
A1080 Col18a1Collagen alpha-1(XVIII) chainLMESYcETWR
A1080 Col18a1Collagen alpha-1(XVIII) chainIFSFDGR
A1080 Col18a1Collagen alpha-1(XVIII) chainTETTGATGQASSLLSGR
A1080 Col18a1Collagen alpha-1(XVIII) chainAVGLSGTFR
A1080 Col18a1Collagen alpha-1(XVIII) chainADDILANPPRLPDR
A1080 Col18a1Collagen alpha-1(XVIII) chainGADFQcFQQAR
A1080 Col18a1Collagen alpha-1(XVIII) chainASQGLELER
A1080 Col18a1Collagen alpha-1(XVIII) chainGAGLFVGQAGTADPDKFQGMISELK
A1080 Col18a1Collagen alpha-1(XVIII) chainGEQGLPGPKGEK
A1080 Col18a1Collagen alpha-1(XVIII) chainEENVAGVGAK
A1080 Col18a1Collagen alpha-1(XVIII) chainADDILANPPR
A1080 Col18a1Collagen alpha-1(XVIII) chainSVWHGSDPSGR
A1080 Col18a1Collagen alpha-1(XVIII) chainLQDLYSIVRR
A1080 Col18a1Collagen alpha-1(XVIII) chainLMESYcETWR
A1080 Col18a1Collagen alpha-1(XVIII) chainIFSFDGR
A1080 Col18a1Collagen alpha-1(XVIII) chainTETTGATGQASSLLSGR
A1080 Col18a1Collagen alpha-1(XVIII) chainADDILANPPRLPDR
A1080 Col18a1Collagen alpha-1(XVIII) chainGADFQcFQQAR
A1080 Col18a1Collagen alpha-1(XVIII) chainASQGLELER
A1080 Col18a1Collagen alpha-1(XVIII) chainGAGLFVGQAGTADPDKFQGMISELK
A1080 Col18a1Collagen alpha-1(XVIII) chainGEQGLPGPKGEK
A1080 Col18a1Collagen alpha-1(XVIII) chainADDILANPPR
A1080 Col18a1Collagen alpha-1(XVIII) chainLMESYcETWR
A1080 Col18a1Collagen alpha-1(XVIII) chainIFSFDGR
A1080 Col18a1Collagen alpha-1(XVIII) chainTETTGATGQASSLLSGR
A1080 Col18a1Collagen alpha-1(XVIII) chainAVGLSGTFR
A1080 Col18a1Collagen alpha-1(XVIII) chainADDILANPPRLPDR
A1080 Col18a1Collagen alpha-1(XVIII) chainGADFQcFQQAR
A1082 Ggt5Gamma-glutamyltransferase 5nVLPLGTGAqWIGVPGELR
A1082 Ggt5Gamma-glutamyltransferase 5nVLPLGTGAqWIGVPGELR
A1082 Ggt5Gamma-glutamyltransferase 5qLFFNGTETLR
A1082 Ggt5Gamma-glutamyltransferase 5qqIDGRGDHHqLSHYNLTGVR
A1086 RhoqRho-related GTP-binding protein RhoQcVVVGDGAVGK
A110F Eml1Echinoderm microtubule-associated protein-like 1LnITEEQQAVLnR
A110F Eml1Echinoderm microtubule-associated protein-like 1LnITEEQQAVLnR
A110F Eml1Echinoderm microtubule-associated protein-like 1LnITEEQQAVLnR
A110G Derl2Derlin-2RnPYVR
A1112 Usp6nlUSP6 N-terminal-like proteinKPLGQLPPESAcVNHLSNGQR
A1112 Usp6nlUSP6 N-terminal-like proteinKPLGQLPPESAcVNHLSNGQR
A1117 Dab1Disabled homolog 1mLcqDRSEATLIK
A1117 Dab1Disabled homolog 1EGNHRFVAIK
A1124 Sh2d3cSH2 domain-containing protein 3CVTRSDGcPnSTSLPHPR
A1124 Sh2d3cSH2 domain-containing protein 3CqQAVQKAQEVSR
A1124 Sh2d3cSH2 domain-containing protein 3CMTEmPKK
A1124 Sh2d3cSH2 domain-containing protein 3CLSSTDLRSHAWYHGR
A1124 Sh2d3cSH2 domain-containing protein 3CVTRSDGcPnSTSLPHPR
A1124 Sh2d3cSH2 domain-containing protein 3CLSSTDLRSHAWYHGR
A1129 Srsf9Serine/arginine-rich splicing factor 9IYVGnLPSDVR
A1129 Srsf9Serine/arginine-rich splicing factor 9SHEGETSYIR
A112C Micu1Calcium uptake protein 1, mitochondrialVmEYENRIR
A112C Micu1Calcium uptake protein 1, mitochondrialmFRLNTLSALAELAVGSR
A112C Micu1Calcium uptake protein 1, mitochondrialLEFERHDPVDGR
A1130 Polr2aDNA-directed RNA polymerase II subunit RPB1AMqKSGRPLK
A1130 Polr2aDNA-directed RNA polymerase II subunit RPB1LGGLMDPR
A1130 Polr2aDNA-directed RNA polymerase II subunit RPB1VVEGVKELSK
A1130 Polr2aDNA-directed RNA polymerase II subunit RPB1AKQDVIEVIEK
A1130 Polr2aDNA-directed RNA polymerase II subunit RPB1LTMEqIAEK
A1133 Srsf1Serine/arginine-rich splicing factor 1SPSYGRSR
A1133 Srsf1Serine/arginine-rich splicing factor 1DGYDYDGYR
A1133 Srsf1Serine/arginine-rich splicing factor 1SHEGETAYIR
A1133 Srsf1Serine/arginine-rich splicing factor 1KEDMTYAVR
A1133 Srsf1Serine/arginine-rich splicing factor 1DGTGVVEFVR
A1133 Srsf1Serine/arginine-rich splicing factor 1TKDIEDVFYK
A1133 Srsf1Serine/arginine-rich splicing factor 1EAGDVcYADVYR
A1133 Srsf1Serine/arginine-rich splicing factor 1WIKnALD
A1133 Srsf1Serine/arginine-rich splicing factor 1DGYDYDGYR
A1133 Srsf1Serine/arginine-rich splicing factor 1KEDMTYAVR
A1133 Srsf1Serine/arginine-rich splicing factor 1DGTGVVEFVR
A1133 Srsf1Serine/arginine-rich splicing factor 1TKDIEDVFYK
A1133 Srsf1Serine/arginine-rich splicing factor 1EAGDVcYADVYR
A114B Tfip11Tuftelin-interacting protein 11EnIAYLTHTERR
A114B Tfip11Tuftelin-interacting protein 11NAQGIInPIEAKqR
A1151 Sema3aSemaphorin-3AEMSSSmTPSqK
A1151 Sema3aSemaphorin-3AAnYANGKnNVPR
A1153 Sema3cSemaphorin-3CQqqQLGEEPQKMR
A1153 Sema3cSemaphorin-3CIIATSqGLLIR
A1153 Sema3cSemaphorin-3CRNQLPES
A1153 Sema3cSemaphorin-3CIcPNDTGGqRSLVnK
A1155 Sema3bSemaphorin-3BLSFQELqAR
A1155 Sema3bSemaphorin-3BNDLGGQRSLVNK
A1156 Plxnc1Plexin-C1VAIHSVLEK
A1156 Plxnc1Plexin-C1FLAPNLK
A1156 Plxnc1Plexin-C1LVPHPMK
A1156 Plxnc1Plexin-C1cIHPFTPcEPSDYER
A1168 Sipa1l1Signal-induced proliferation-associated 1-like protein 1VInAENAAHK
A1168 Sipa1l1Signal-induced proliferation-associated 1-like protein 1LnAGKGDGK
A1168 Sipa1l1Signal-induced proliferation-associated 1-like protein 1ASVVSTDGAPK
A1168 Sipa1l1Signal-induced proliferation-associated 1-like protein 1LAFNTPK
A1168 Sipa1l1Signal-induced proliferation-associated 1-like protein 1SQTERPVTADR
A1168 Sipa1l1Signal-induced proliferation-associated 1-like protein 1TGPAESMDSR
A1168 Sipa1l1Signal-induced proliferation-associated 1-like protein 1AYEVQR
A1168 Sipa1l1Signal-induced proliferation-associated 1-like protein 1LIDLESPTPESQKnFK
A1168 Sipa1l1Signal-induced proliferation-associated 1-like protein 1QKSmPEGFGVSR
A1168 Sipa1l1Signal-induced proliferation-associated 1-like protein 1HqSDGNEIAHTRLR
A1168 Sipa1l1Signal-induced proliferation-associated 1-like protein 1VInAENAAHK
A1168 Sipa1l1Signal-induced proliferation-associated 1-like protein 1LnAGKGDGK
A1168 Sipa1l1Signal-induced proliferation-associated 1-like protein 1ASVVSTDGAPK
A1168 Sipa1l1Signal-induced proliferation-associated 1-like protein 1LAFNTPK
A1168 Sipa1l1Signal-induced proliferation-associated 1-like protein 1SQTERPVTADR
A1168 Sipa1l1Signal-induced proliferation-associated 1-like protein 1TGPAESMDSR
A1168 Sipa1l1Signal-induced proliferation-associated 1-like protein 1AYEVQR
A1168 Sipa1l1Signal-induced proliferation-associated 1-like protein 1LIDLESPTPESQKnFK
A1168 Sipa1l1Signal-induced proliferation-associated 1-like protein 1QKSmPEGFGVSR
A1168 Sipa1l1Signal-induced proliferation-associated 1-like protein 1HqSDGNEIAHTRLR
A116B ThadaThyroid adenoma-associated protein homologVAmTLVqK
A116B ThadaThyroid adenoma-associated protein homologVQGPQGSLWNDSSSPIWQSMcGLLSIFTK
A116B ThadaThyroid adenoma-associated protein homologLSSVTAGqFqDSEK
A116B ThadaThyroid adenoma-associated protein homologTARAHGHLQSATqAWENLVcSAR
A116D Fam208bProtein FAM208BcEGEYVFSLDSK
A116D Fam208bProtein FAM208BIILELNK
A116D Fam208bProtein FAM208BnNKVIGSPR
A116D Fam208bProtein FAM208BDqETEPRLISPnK
A116D Fam208bProtein FAM208BEFKDTTR
A116D Fam208bProtein FAM208BLPSPAFVKnGIK
A117A Sema3dSemaphorin-3DSVYPVAGAPTFKR
A117A Sema3dSemaphorin-3DDANAEcANFIR
A117F Oscp1Protein OSCP1DKVqnSnGR
A117F Oscp1Protein OSCP1LMGGMEIK
A1192 Tgfb1Transforming growth factor beta-1LHVEINGISPK
A1195 PtprjReceptor-type tyrosine-protein phosphatase etaMVWEKNVYAIVMLTK
A1196 PtprbReceptor-type tyrosine-protein phosphatase betaSLLnIMMLVPHK
A1196 PtprbReceptor-type tyrosine-protein phosphatase betaTVPEKVR
A1196 PtprbReceptor-type tyrosine-protein phosphatase betaLTSLNVK
A1196 PtprbReceptor-type tyrosine-protein phosphatase betaYKMqILTVSGGLFSK
A1196 PtprbReceptor-type tyrosine-protein phosphatase betaTVPEKVR
A1196 PtprbReceptor-type tyrosine-protein phosphatase betaLTSLNVK
A1197 PtprvReceptor-type tyrosine-protein phosphatase VLEAEHPAnITKNR
A1197 PtprvReceptor-type tyrosine-protein phosphatase VNSPSDLTIGWAPAPGqmEGYKVTWHQDGSqR
A1197 PtprvReceptor-type tyrosine-protein phosphatase VYPHVLPYDHSR
A1201 PtprkReceptor-type tyrosine-protein phosphatase kappaSGYIAIDDIQVLSYPcDK
A1201 PtprkReceptor-type tyrosine-protein phosphatase kappaTKcAEPmR
A1201 PtprkReceptor-type tyrosine-protein phosphatase kappaARLQLPTMK
A1203 PtprgReceptor-type tyrosine-protein phosphatase gammaIIGAmAIFFQVSPR
A1203 PtprgReceptor-type tyrosine-protein phosphatase gammaVqAVcRnDMR
A1203 PtprgReceptor-type tyrosine-protein phosphatase gammaVGDEYqELqLDGFDnESSnKTWMK
A120B Tmf1TATA element modulatory factorIDSFSVQSLDSR
A120B Tmf1TATA element modulatory factorDEmFRVK
A120B Tmf1TATA element modulatory factorLQAqLESEKnK
A120B Tmf1TATA element modulatory factorQVLDGKEEVEK
A120B Tmf1TATA element modulatory factorAATEELLANK
A120B Tmf1TATA element modulatory factorLQAqLESEKNK
A120B Tmf1TATA element modulatory factorDEQIQGLMEEGEK
A120B Tmf1TATA element modulatory factorqALSqAQKSIDR
A120G DgkaDiacylglycerol kinase alphaFnSRMK
A120J UstUronyl 2-sulfotransferaseDPVSRFLSnYFFR
A120J UstUronyl 2-sulfotransferaseLGNmTVTVR
A1215 GanabNeutral alpha-glucosidase ABYRVPDVLVADPPTAR
A1215 GanabNeutral alpha-glucosidase ABIRIDELEPR
A1215 GanabNeutral alpha-glucosidase ABLSFQHDPETSVLILR
A1215 GanabNeutral alpha-glucosidase ABMLDYLQGSGETPQTDIR
A1215 GanabNeutral alpha-glucosidase ABHEFLLR
A1215 GanabNeutral alpha-glucosidase ABLDLLEDR
A1215 GanabNeutral alpha-glucosidase ABFGAVWTGDNTAEWDHLK
A1217 Lgals1Galectin-1DSNNLcLHFNPR
A1217 Lgals1Galectin-1FNAHGDANTIVcNTK
A1217 Lgals1Galectin-1SFVLnLGK
A1217 Lgals1Galectin-1LPDGHEFK
A121C Mmrn1Multimerin-1nAYLSLEGKVGEDnSR
A121C Mmrn1Multimerin-1TSnAVYR
A121C Mmrn1Multimerin-1nQRPSYqKPSFETTR
A1222 Rpl560S ribosomal protein L5IEGDMIVcAAYAHELPK
A1222 Rpl560S ribosomal protein L5GAVDGGLSIPHSTK
A1222 Rpl560S ribosomal protein L5QFSQYIK
A1222 Rpl560S ribosomal protein L5NNVTPDMMEEMYKK
A1222 Rpl560S ribosomal protein L5EFNAEVHR
A1222 Rpl560S ribosomal protein L5YnTPKYR
A1222 Rpl560S ribosomal protein L5NNVTPDMMEEMYK
A1222 Rpl560S ribosomal protein L5YLMEEDEDAYKK
A1222 Rpl560S ribosomal protein L5GAVDGGLSIPHSTKR
A1222 Rpl560S ribosomal protein L5IEGDMIVcAAYAHELPK
A1222 Rpl560S ribosomal protein L5GAVDGGLSIPHSTK
A1222 Rpl560S ribosomal protein L5QFSQYIK
A1222 Rpl560S ribosomal protein L5NNVTPDMMEEMYKK
A1222 Rpl560S ribosomal protein L5EFNAEVHR
A1222 Rpl560S ribosomal protein L5NNVTPDMMEEMYK
A1222 Rpl560S ribosomal protein L5RFPGYDSESK
A1222 Rpl560S ribosomal protein L5HIMGQNVADYMR
A1222 Rpl560S ribosomal protein L5YLMEEDEDAYKK
A1222 Rpl560S ribosomal protein L5DIIcQIAYAR
A1222 Rpl560S ribosomal protein L5GAVDGGLSIPHSTKR
A1222 Rpl560S ribosomal protein L5IEGDMIVcAAYAHELPK
A1222 Rpl560S ribosomal protein L5GAVDGGLSIPHSTK
A1222 Rpl560S ribosomal protein L5QFSQYIK
A1222 Rpl560S ribosomal protein L5NNVTPDMMEEMYKK
A1222 Rpl560S ribosomal protein L5EFNAEVHR
A1222 Rpl560S ribosomal protein L5YnTPKYR
A1222 Rpl560S ribosomal protein L5NNVTPDMMEEMYK
A1222 Rpl560S ribosomal protein L5RFPGYDSESK
A1222 Rpl560S ribosomal protein L5HIMGQNVADYMR
A1222 Rpl560S ribosomal protein L5YLMEEDEDAYKK
A1222 Rpl560S ribosomal protein L5DIIcQIAYAR
A1222 Rpl560S ribosomal protein L5GAVDGGLSIPHSTKR
A1228 PgrProgesterone receptorFYQLTK
A1228 PgrProgesterone receptorFYQLTK
A122C Slc16a1Monocarboxylate transporter 1SDANTDLIGGSPK
A122C Slc16a1Monocarboxylate transporter 1AAQSPQQHSSGDPTEEESPV
A1240 WrnWerner syndrome ATP-dependent helicase homologMDVPPAILATnK
A1241 BlmBloom syndrome protein homologLAqnLSSKnPK
A1241 BlmBloom syndrome protein homologQAASGWNVER
A1241 BlmBloom syndrome protein homologKLnNQPSLSKPK
A1241 BlmBloom syndrome protein homologLAqnLSSKnPK
A1241 BlmBloom syndrome protein homologQAASGWNVER
A1241 BlmBloom syndrome protein homologKLnNQPSLSKPK
A1241 BlmBloom syndrome protein homologmRImAAVPLNnLqEQLQR
A1243 Ube3aUbiquitin-protein ligase E3AEFWEIVHSFTDEQK
A1243 Ube3aUbiquitin-protein ligase E3AEFWEIVHSFTDEQK
A1243 Ube3aUbiquitin-protein ligase E3AEFWEIVHSFTDEQK
A1244 Nedd4lE3 ubiquitin-protein ligase NEDD4-likeREYIDLVIqWR
A1244 Nedd4lE3 ubiquitin-protein ligase NEDD4-likeMAYmPKNGGqDEEnSEQR
A1244 Nedd4lE3 ubiquitin-protein ligase NEDD4-likeVQKQMNAFLEGFTELLPIDLIK
A1244 Nedd4lE3 ubiquitin-protein ligase NEDD4-likeREYIDLVIqWR
A1244 Nedd4lE3 ubiquitin-protein ligase NEDD4-likeMAYmPKNGGqDEEnSEQR
A1244 Nedd4lE3 ubiquitin-protein ligase NEDD4-likeVQKQMNAFLEGFTELLPIDLIK
A124C Slc16a7Monocarboxylate transporter 2SKqDEVTVK
A1252 Rgs9Regulator of G-protein signaling 9VALEGSSGLEPK
A1252 Rgs9Regulator of G-protein signaling 9TMDITVKGLR
A1252 Rgs9Regulator of G-protein signaling 9EIMYYQQALMR
A1252 Rgs9Regulator of G-protein signaling 9WINIDGK
A1252 Rgs9Regulator of G-protein signaling 9YVLDAAqTHIYmLmKK
A1252 Rgs9Regulator of G-protein signaling 9HQGqqYRPR
A125D D7Ertd443eCentrosomal protein C10orf90 homologqSLLPVRANK
A125D D7Ertd443eCentrosomal protein C10orf90 homologNLqSDVTER
A1265 Rps6ka1Ribosomal protein S6 kinase alpha-1nLVFSDGYVVK
A1265 Rps6ka1Ribosomal protein S6 kinase alpha-1nLVFSDGYVVK
A1265 Rps6ka1Ribosomal protein S6 kinase alpha-1mEQDPKLPR
A1265 Rps6ka1Ribosomal protein S6 kinase alpha-1nLVFSDGYVVK
A1265 Rps6ka1Ribosomal protein S6 kinase alpha-1nLVFSDGYVVK
A1265 Rps6ka1Ribosomal protein S6 kinase alpha-1nLVFSDGYVVK
A1267 FgrTyrosine-protein kinase FgrIADFGLAR
A1276 CluClusterinNSTGcLKMK
A1276 CluClusterinEIQNAVQGVK
A1277 Chek1Serine/threonine-protein kinase Chk1InLVEMDEK
A1277 Chek1Serine/threonine-protein kinase Chk1TYLnPWKK
A1277 Chek1Serine/threonine-protein kinase Chk1InLVEMDEK
A1277 Chek1Serine/threonine-protein kinase Chk1InLVEMDEK
A1277 Chek1Serine/threonine-protein kinase Chk1TYLnPWKK
A127A Sfrp4Secreted frizzled-related sequence protein 4LQEqQRTIQDK
A127A Sfrp4Secreted frizzled-related sequence protein 4HmPWNITR
A127A Sfrp4Secreted frizzled-related sequence protein 4HmPWNITR
A127J Vangl2Vang-like protein 2VAVWILEKYYHDFPVYnPALLNLPK
A1285 Top2bDNA topoisomerase 2-betaqIMEnAEINNIIK
A1285 Top2bDNA topoisomerase 2-betaVTGGRnGYGAK
A1292 Ube2nUbiquitin-conjugating enzyme E2 NLLAEPVPGIK
A1292 Ube2nUbiquitin-conjugating enzyme E2 NYFHVVIAGPQDSPFEGGTFK
A1292 Ube2nUbiquitin-conjugating enzyme E2 NETQRLLAEPVPGIK
A1292 Ube2nUbiquitin-conjugating enzyme E2 NTNEAQAIETAR
A1292 Ube2nUbiquitin-conjugating enzyme E2 NLELFLPEEYPMAAPK
A1292 Ube2nUbiquitin-conjugating enzyme E2 NLELFLPEEYPMAAPK
A1292 Ube2nUbiquitin-conjugating enzyme E2 NLLAEPVPGIK
A1292 Ube2nUbiquitin-conjugating enzyme E2 NYFHVVIAGPQDSPFEGGTFK
A1292 Ube2nUbiquitin-conjugating enzyme E2 NETQRLLAEPVPGIK
A1292 Ube2nUbiquitin-conjugating enzyme E2 NTNEAQAIETAR
A1292 Ube2nUbiquitin-conjugating enzyme E2 NLELFLPEEYPMAAPK
A1292 Ube2nUbiquitin-conjugating enzyme E2 NLLAEPVPGIK
A1292 Ube2nUbiquitin-conjugating enzyme E2 NYFHVVIAGPQDSPFEGGTFK
A1292 Ube2nUbiquitin-conjugating enzyme E2 NETQRLLAEPVPGIK
A1292 Ube2nUbiquitin-conjugating enzyme E2 NLELFLPEEYPMAAPK
A1297 KarsLysine--tRNA ligaseRISMVEELEK
A1297 KarsLysine--tRNA ligaseISmVEELEK
A1297 KarsLysine--tRNA ligaseILDDIcVAK
A1297 KarsLysine--tRNA ligaseVTGEDPYPHK
A1297 KarsLysine--tRNA ligaseRISMVEELEK
A1297 KarsLysine--tRNA ligaseISmVEELEK
A1297 KarsLysine--tRNA ligaseILDDIcVAK
A1297 KarsLysine--tRNA ligaseVTGEDPYPHK
A1297 KarsLysine--tRNA ligaseVAGRIQAK
A1299 Net1Neuroepithelial cell-transforming gene 1 proteinVqDFLqR
A1299 Net1Neuroepithelial cell-transforming gene 1 proteinSPASAqKSFSR
A1299 Net1Neuroepithelial cell-transforming gene 1 proteinVTSLAnLISPVR
A1301 Tgfb1i1Transforming growth factor beta-1-induced transcript 1 proteinMPPSSTLqmK
A1301 Tgfb1i1Transforming growth factor beta-1-induced transcript 1 proteinMMGPAcLTYqR
A1301 Tgfb1i1Transforming growth factor beta-1-induced transcript 1 proteincVSALGR
A1301 Tgfb1i1Transforming growth factor beta-1-induced transcript 1 proteinMPPSSTLqmK
A1301 Tgfb1i1Transforming growth factor beta-1-induced transcript 1 proteincVSALGR
A1301 Tgfb1i1Transforming growth factor beta-1-induced transcript 1 proteincVSALGR
A1301 Tgfb1i1Transforming growth factor beta-1-induced transcript 1 proteinIIYTDEIMSqFPSSKmAEGEEK
A1303 Mcm7DNA replication licensing factor MCM7FLqEFYYEnELGK
A130A Sh3glb1Endophilin B1 testis variantITQSEFDRQAEITR
A130A Sh3glb1Endophilin B1 testis variantMnImDFNVKK
A130A Sh3glb1Endophilin B1 testis variantIMKQTEVLLqPnPNAR
A1318 AtmSerine-protein kinase ATMKYWcEVSQQQWLELFSLYFR
A1318 AtmSerine-protein kinase ATMFQSSVGFSVqQNLK
A1318 AtmSerine-protein kinase ATMYRPnDFSANQcQK
A1318 AtmSerine-protein kinase ATMMMEVQKK
A1318 AtmSerine-protein kinase ATMLAGGLNLPK
A1318 AtmSerine-protein kinase ATMmLQPLTR
A1318 AtmSerine-protein kinase ATMcLKEVALcQGK
A1318 AtmSerine-protein kinase ATMESTDYSVPcKR
A1318 AtmSerine-protein kinase ATMSIAnqIqK
A1318 AtmSerine-protein kinase ATMmAVNqTGER
A1318 AtmSerine-protein kinase ATMSqRTmLAVVDYLR
A1318 AtmSerine-protein kinase ATMDGMKISSYK
A1318 AtmSerine-protein kinase ATMLKcqDLLnYVMDTVK
A1319 Ehd1EH domain-containing protein 1QEESLMPSQAVK
A1319 Ehd1EH domain-containing protein 1FHEFHSPALEDADFDNKPMVLLVGQYSTGK
A1319 Ehd1EH domain-containing protein 1IINTPEVVR
A1319 Ehd1EH domain-containing protein 1DIQSLPR
A1319 Ehd1EH domain-containing protein 1ELVNNLGEIYQK
A1319 Ehd1EH domain-containing protein 1EHQISSGDFPSLR
A1319 Ehd1EH domain-containing protein 1EMPNVFGK
A1319 Ehd1EH domain-containing protein 1LLDTVDDMLANDIAR
A1319 Ehd1EH domain-containing protein 1VVLNKADqIETQQLMR
A1319 Ehd1EH domain-containing protein 1KLnAFGNAFLNR
A1319 Ehd1EH domain-containing protein 1QEESLMPSQAVK
A1319 Ehd1EH domain-containing protein 1FHEFHSPALEDADFDNKPMVLLVGQYSTGK
A1319 Ehd1EH domain-containing protein 1IINTPEVVR
A1319 Ehd1EH domain-containing protein 1DIQSLPR
A1319 Ehd1EH domain-containing protein 1ELVNNLGEIYQK
A1319 Ehd1EH domain-containing protein 1EHQISSGDFPSLR
A1319 Ehd1EH domain-containing protein 1EMPNVFGK
A1319 Ehd1EH domain-containing protein 1LLDTVDDMLANDIAR
A1319 Ehd1EH domain-containing protein 1ADQIETQQLMR
A1319 Ehd1EH domain-containing protein 1VVLNKADqIETQQLMR
A1319 Ehd1EH domain-containing protein 1KLnAFGNAFLNR
A131J Slc17a8Vesicular glutamate transporter 3qDWADPEnLSEDK
A1322 PigrPolymeric immunoglobulin receptorAIPNPGPFAnER
A1323 Kif13aKinesin-like protein KIF13AGAIVSEPAIQAR
A1323 Kif13aKinesin-like protein KIF13ATALEEqRLMYER
A1323 Kif13aKinesin-like protein KIF13ATLNSNDPVQnVVQVLEKqYLEEK
A1323 Kif13aKinesin-like protein KIF13AREYLDEQIK
A1323 Kif13aKinesin-like protein KIF13AqLESMGISLETSGIK
A1323 Kif13aKinesin-like protein KIF13ADETIAVPLEENSALPK
A1323 Kif13aKinesin-like protein KIF13AGAIVSEPAIQAR
A1323 Kif13aKinesin-like protein KIF13ATALEEqRLMYER
A1323 Kif13aKinesin-like protein KIF13ATLNSNDPVQnVVQVLEKqYLEEK
A1323 Kif13aKinesin-like protein KIF13AREYLDEQIK
A1323 Kif13aKinesin-like protein KIF13AqLESMGISLETSGIK
A1323 Kif13aKinesin-like protein KIF13AEqLSqAEAMKAPELK
A1323 Kif13aKinesin-like protein KIF13ADETIAVPLEENSALPK
A1324 Ap3d1AP-3 complex subunit delta-1NmELNVLDSLnTK
A1324 Ap3d1AP-3 complex subunit delta-1nLqDLVRGIR
A1324 Ap3d1AP-3 complex subunit delta-1AVLIMYK
A1324 Ap3d1AP-3 complex subunit delta-1EGVLGVEK
A1324 Ap3d1AP-3 complex subunit delta-1qDNIAVK
A1331 Ehd3EH domain-containing protein 3FHEFHSPALEDADFDNKPMVLLVGQYSTGK
A1331 Ehd3EH domain-containing protein 3DIQSLPR
A1331 Ehd3EH domain-containing protein 3MQDQLQAQDFSK
A1331 Ehd3EH domain-containing protein 3ELVNNLAEIYGR
A1331 Ehd3EH domain-containing protein 3QEETQRPVQMVK
A1331 Ehd3EH domain-containing protein 3EHQISPGDFPnLK
A1331 Ehd3EH domain-containing protein 3ADQIETQQLMR
A1331 Ehd3EH domain-containing protein 3YLLEQDFPGMR
A1331 Ehd3EH domain-containing protein 3VVLNKADqIETQQLMR
A1331 Ehd3EH domain-containing protein 3KLnAFGNAFLNR
A1337 Eif2s1Eukaryotic translation initiation factor 2 subunit 1EVLInNInR
A1337 Eif2s1Eukaryotic translation initiation factor 2 subunit 1AGLNcSTETMPIK
A1337 Eif2s1Eukaryotic translation initiation factor 2 subunit 1HVAEVLEYTK
A133G Dnajc16DnaJ homolog subfamily C member 16KYcVVLLTAETNK
A1344 RelbTranscription factor RelBIQLGIDPYnAGSLKNHQEVDMnVVR
A1344 RelbTranscription factor RelBMDPILSEPVYDK
A1345 Nfkb2Nuclear factor NF-kappa-B p100 subunitGHTPLDLTcSTKVK
A1345 Nfkb2Nuclear factor NF-kappa-B p100 subunitSLVDTYR
A1345 Nfkb2Nuclear factor NF-kappa-B p100 subunitNFRGHTPLDLTcSTK
A1345 Nfkb2Nuclear factor NF-kappa-B p100 subunitnmMEIMIQK
A1345 Nfkb2Nuclear factor NF-kappa-B p100 subunitKnMmEIMIQK
A1351 Eif2s3xEukaryotic translation initiation factor 2 subunit 3, X-linkedIVLTNPVcTEVGEK
A1351 Eif2s3xEukaryotic translation initiation factor 2 subunit 3, X-linkedIDPTLcR
A1351 Eif2s3xEukaryotic translation initiation factor 2 subunit 3, X-linkedQDLATLDVTK
A1351 Eif2s3xEukaryotic translation initiation factor 2 subunit 3, X-linkedScGSSTPDEFPTDIPGTK
A1351 Eif2s3xEukaryotic translation initiation factor 2 subunit 3, X-linkedIVLTNPVcTEVGEK
A1351 Eif2s3xEukaryotic translation initiation factor 2 subunit 3, X-linkedIDPTLcR
A1351 Eif2s3xEukaryotic translation initiation factor 2 subunit 3, X-linkedScGSSTPDEFPTDIPGTK
A1356 Adcy1Adenylate cyclase type 1VLcGVLGLRK
A135C Abcc3Canalicular multispecific organic anion transporter 2ILSALAEGK
A135C Abcc3Canalicular multispecific organic anion transporter 2VVqRLLEAWQK
A135F Cyp27b125-hydroxyvitamin D-1 alpha hydroxylase, mitochondrialSINLqFVDR
A1361 Adcy6Adenylate cyclase type 6GYIqARLHLQHEnR
A136B Trps1Zinc finger transcription factor Trps1QNnGEQIIR
A136B Trps1Zinc finger transcription factor Trps1KDLQISGLSEK
A136B Trps1Zinc finger transcription factor Trps1cTIKHcPFcPR
A136B Trps1Zinc finger transcription factor Trps1QNnGEQIIR
A136B Trps1Zinc finger transcription factor Trps1KDLQISGLSEK
A136B Trps1Zinc finger transcription factor Trps1cTIKHcPFcPR
A1370 Cbx5Chromobox protein homolog 5EAnVKcPQIVIAFYEER
A1374 LmnaPrelamin-A/CSLETENAGLR
A1374 LmnaPrelamin-A/CTLEGELHDLR
A1374 LmnaPrelamin-A/CEAALSTALSEK
A1374 LmnaPrelamin-A/CAQNTWGcGSSLR
A1374 LmnaPrelamin-A/CNIYSEELR
A1374 LmnaPrelamin-A/CAAYEAELGDAR
A1374 LmnaPrelamin-A/CITESEEVVSR
A1374 LmnaPrelamin-A/CLKDLEALLNSK
A1374 LmnaPrelamin-A/CSLETENAGLR
A1374 LmnaPrelamin-A/CLQLELSK
A1374 LmnaPrelamin-A/CTLEGELHDLR
A1374 LmnaPrelamin-A/CEGDLLAAQAR
A1374 LmnaPrelamin-A/CEAALSTALSEK
A1374 LmnaPrelamin-A/CAQHEDQVEQYKK
A1374 LmnaPrelamin-A/CKQLQDEMLR
A1374 LmnaPrelamin-A/CLSPSPTSQR
A1374 LmnaPrelamin-A/CVREEFK
A1374 LmnaPrelamin-A/CLQTLKEELDFQK
A1374 LmnaPrelamin-A/CLAVYIDR
A1374 LmnaPrelamin-A/CAQNTWGcGSSLR
A1374 LmnaPrelamin-A/CTVLcGTcGQPADK
A1374 LmnaPrelamin-A/CLRDLEDSLAR
A1374 LmnaPrelamin-A/CSNEDqSmGnWqIRR
A1374 LmnaPrelamin-A/CNIYSEELR
A1374 LmnaPrelamin-A/CmQQQLDEYqELLDIK
A1374 LmnaPrelamin-A/CAAYEAELGDAR
A1374 LmnaPrelamin-A/CITESEEVVSR
A1374 LmnaPrelamin-A/CLKDLEALLNSK
A1378 Trim28Transcription intermediary factor 1-betamFKQFNK
A1378 Trim28Transcription intermediary factor 1-betaLDLDLTSDSQPPVFK
A1379 Hmgb2High mobility group protein B2KHPDSSVNFAEFSK
A1379 Hmgb2High mobility group protein B2SKFEDLAK
A1379 Hmgb2High mobility group protein B2LGEMWSEQSAK
A1379 Hmgb2High mobility group protein B2MSSYAFFVQTcR
A1379 Hmgb2High mobility group protein B2YEKDIAAYR
A1379 Hmgb2High mobility group protein B2LGEmWSEqSAK
A1379 Hmgb2High mobility group protein B2HPDSSVNFAEFSK
A1387 Cdk4Cyclin-dependent kinase 4LADFGLAR
A1387 Cdk4Cyclin-dependent kinase 4LADFGLAR
A1388 Cdk6Cyclin-dependent kinase 6LADFGLAR
A138A Spag1Sperm-associated antigen 1DGVEDGGSAEPAEK
A138A Spag1Sperm-associated antigen 1DGVEDGGSAEPAEK
A138A Spag1Sperm-associated antigen 1DGVEDGGSAEPAEK
A138B Tshz3Teashirt homolog 3EASPSAEPVENGK
A138B Tshz3Teashirt homolog 3TLqQVSQNR
A1395 Msh2DNA mismatch repair protein Msh2QPLmDRNR
A1395 Msh2DNA mismatch repair protein Msh2DSLIIIDELGR
A1402 Exo1Exonuclease 1LPScKKPLSPVK
A1405 Rad50DNA repair protein RAD50SYEDELEPLK
A1405 Rad50DNA repair protein RAD50TLDqAIMKFHSmK
A1405 Rad50DNA repair protein RAD50TLEGVITRMK
A1405 Rad50DNA repair protein RAD50TVQQVNQEK
A1405 Rad50DNA repair protein RAD50TVQqVNqEKQEK
A1405 Rad50DNA repair protein RAD50SYEDELEPLK
A1405 Rad50DNA repair protein RAD50TLDqAIMKFHSmK
A1405 Rad50DNA repair protein RAD50TLEGVITRMK
A1405 Rad50DNA repair protein RAD50TVQQVNQEK
A1405 Rad50DNA repair protein RAD50TVQqVNqEKQEK
A1406 Rint1RAD50-interacting protein 1LqLGqLASMESSVFDDMInLLERLK
A140I Rnf114RING finger protein 114DGAAQSAKPASETDPLSR
A1410 Col6a1Collagen alpha-1(VI) chainVLLFSDGNSQGATAEAIEK
A1410 Col6a1Collagen alpha-1(VI) chainVAVVQYSGQGQQQPGR
A1410 Col6a1Collagen alpha-1(VI) chainGVLYQTVSR
A1410 Col6a1Collagen alpha-1(VI) chainNNVEQVccSFEcQAAR
A1410 Col6a1Collagen alpha-1(VI) chainDTTPLSVLcGADIQVVSVGIK
A1410 Col6a1Collagen alpha-1(VI) chainnFTAADWGHSR
A1410 Col6a1Collagen alpha-1(VI) chainGTYTDcAIKK
A1410 Col6a1Collagen alpha-1(VI) chainIALVITDGR
A1410 Col6a1Collagen alpha-1(VI) chainLLPPTqNNR
A1410 Col6a1Collagen alpha-1(VI) chainYLIVVTDGHPLEGYKEPcGGLEDAVNEAK
A1410 Col6a1Collagen alpha-1(VI) chainVFSVAITPDHLEPR
A1410 Col6a1Collagen alpha-1(VI) chainNLVWNAGALHYSDEVEIIR
A1410 Col6a1Collagen alpha-1(VI) chainGLEELLIGGSHLK
A1410 Col6a1Collagen alpha-1(VI) chainTAEYDVAFGER
A1410 Col6a1Collagen alpha-1(VI) chainnITAQIcIDK
A141H Lin54Protein lin-54 homologLGNQTLKPDGQK
A1426 Rfc5Replication factor C subunit 5RALnILQSTNMAFGK
A1427 Pold1DNA polymerase delta catalytic subunitVqMDMLqVLLR
A1427 Pold1DNA polymerase delta catalytic subunitQmIEKTK
A1427 Pold1DNA polymerase delta catalytic subunitLLERLmVLVnnVEmAR
A1427 Pold1DNA polymerase delta catalytic subunitVqmDmLQVLLREHK
A1427 Pold1DNA polymerase delta catalytic subunitQGLLmPVVK
A1427 Pold1DNA polymerase delta catalytic subunitVqMDMLqVLLR
A1427 Pold1DNA polymerase delta catalytic subunitLLERLmVLVnnVEmAR
A1427 Pold1DNA polymerase delta catalytic subunitVqmDmLQVLLREHK
A1427 Pold1DNA polymerase delta catalytic subunitQGLLmPVVK
A1431 Pola1DNA polymerase alpha catalytic subunitmNLEVIYGDTDSImInTNSTnLEEVFKLGNK
A1431 Pola1DNA polymerase alpha catalytic subunitqFFPLRVLQDYR
A145D  Uncharacterized protein C12orf60 homologERLIqAAK
A145D  Uncharacterized protein C12orf60 homologVLTAMTSAVEK
A1461 Cul1Cullin-1AGIqqVYTR
A1461 Cul1Cullin-1NIEEDRK
A1461 Cul1Cullin-1FINNNAVTK
A1461 Cul1Cullin-1DLNEQFK
A1461 Cul1Cullin-1AGIqqVYTR
A1461 Cul1Cullin-1FINNNAVTK
A1461 Cul1Cullin-1DLNEQFK
A1466 Fn1FibronectinVTYSSPEDGIR
A1466 Fn1FibronectinTFYScTTEGR
A1466 Fn1FibronectinLGVRPSQGGEAPR
A1466 Fn1FibronectinnNqKSEPLIGR
A1466 Fn1FibronectinVTYSSPEDGIR
A1466 Fn1FibronectinTFYScTTEGR
A1466 Fn1FibronectinESNPLTAQQTTK
A1466 Fn1FibronectinLGVRPSQGGEAPR
A1466 Fn1FibronectinnNqKSEPLIGR
A1468 PlgPlasminogenEAQLPVIEnK
A1468 PlgPlasminogenKqLAAGGVSDcLAK
A146B U2af2Splicing factor U2AF 65 kDa subunitVSmSDFYKFEqqLK
A146B U2af2Splicing factor U2AF 65 kDa subunitnPDQRSDSqDR
A146B U2af2Splicing factor U2AF 65 kDa subunitDVFISAAER
A146B U2af2Splicing factor U2AF 65 kDa subunitDVYTGDALR
A146B U2af2Splicing factor U2AF 65 kDa subunitSIEIPRPVDGVEVPGcGK
A146B U2af2Splicing factor U2AF 65 kDa subunitSVDETTQAMAFDGIIFqGqSLK
A146B U2af2Splicing factor U2AF 65 kDa subunitYcDPDSYHR
A147H Lilrb3Leukocyte immunoglobulin-like receptor subfamily B member 3EGSAQQPLR
A1483 Snapc4snRNA-activating protein complex subunit 4TVSELLR
A1483 Snapc4snRNA-activating protein complex subunit 4QLWHGTYQnK
A1483 Snapc4snRNA-activating protein complex subunit 4RGQRPR
A1483 Snapc4snRNA-activating protein complex subunit 4QLWHGTYQNK
A1483 Snapc4snRNA-activating protein complex subunit 4LqRLLqPK
A1483 Snapc4snRNA-activating protein complex subunit 4TVSELLR
A1483 Snapc4snRNA-activating protein complex subunit 4QLWHGTYQnK
A1483 Snapc4snRNA-activating protein complex subunit 4RGQRPR
A1483 Snapc4snRNA-activating protein complex subunit 4QLWHGTYQNK
A1483 Snapc4snRNA-activating protein complex subunit 4LqRLLqPK
A1485 Ercc2TFIIH basal transcription factor complex helicase XPD subunitEnDFLTFDAmRHAAqcVGR
A1485 Ercc2TFIIH basal transcription factor complex helicase XPD subunitQMAQPFHR
A1485 Ercc2TFIIH basal transcription factor complex helicase XPD subunitEnDFLTFDAmRHAAqcVGR
A1485 Ercc2TFIIH basal transcription factor complex helicase XPD subunitEnDFLTFDAmRHAAqcVGR
A1485 Ercc2TFIIH basal transcription factor complex helicase XPD subunitQMAQPFHR
A1490 ItgavIntegrin alpha VEqLqPHEnGEGnSET
A1490 ItgavIntegrin alpha VqVVcDLGnPmK
A1490 ItgavIntegrin alpha VGSDGKLQEVGQVSVSLqR
A1490 ItgavIntegrin alpha VEqLqPHEnGEGnSET
A1490 ItgavIntegrin alpha VqVVcDLGnPmK
A1490 ItgavIntegrin alpha VGSDGKLQEVGQVSVSLqR
A1491 Col1a1Collagen alpha-1(I) chainNGDRGETGPAGPAGPIGPAGAR
A1491 Col1a1Collagen alpha-1(I) chainnGDRGETGPAGPAGPIGPAGAR
A1491 Col1a1Collagen alpha-1(I) chainGQAGVmGFPGPK
A1491 Col1a1Collagen alpha-1(I) chainNGDRGETGPAGPAGPIGPAGAR
A1491 Col1a1Collagen alpha-1(I) chainnGDRGETGPAGPAGPIGPAGAR
A1491 Col1a1Collagen alpha-1(I) chainGQAGVmGFPGPK
A1494 FggFibrinogen gamma chainYLQEIYNSNNQK
A1494 FggFibrinogen gamma chainTSTADYAMFR
A1494 FggFibrinogen gamma chainSRWYSMK
A1497 PlauUrokinase-type plasminogen activatorESESDYLYPKNLK
A1497 PlauUrokinase-type plasminogen activatorSIqTIcLPPR
A1499 F11Coagulation factor XIYnGVWHLVGITSWGEGcGqK
A1499 F11Coagulation factor XIMcLLKYTR
A1499 F11Coagulation factor XIERPGVYTNVAK
A149A Odz2Teneurin-2VLDQAGQR
A149B Uimc1BRCA1-A complex subunit RAP80EmQSTLSQLNLNESPIK
A149B Uimc1BRCA1-A complex subunit RAP80MAVGDKQVAnR
A149B Uimc1BRCA1-A complex subunit RAP80EmQSTLSQLNLNESPIK
A1500 F10Coagulation factor XLEDAcqGDSGGPHVTRFK
A1505 Col7a1Collagen alpha-1(VII) chainGQGVKLFAVGIK
A1505 Col7a1Collagen alpha-1(VII) chainGDPGAGLPGPR
A1505 Col7a1Collagen alpha-1(VII) chainGEQGEKGAAGAAGLK
A1505 Col7a1Collagen alpha-1(VII) chainEGLIGFPGER
A150C Mup1Major urinary protein 1AGEYSVTYDGFNTFTIPK
A150C Mup1Major urinary protein 1ENIIDLSNANR
A150C Mup1Major urinary protein 1EPDLSSDIKER
A150C Mup1Major urinary protein 1EKIEDNGNFR
A150C Mup1Major urinary protein 1TDYDNFLMAHLINEK
A150C Mup1Major urinary protein 1DGETFQLMGLYGR
A150D Kiaa0226lUncharacterized protein KIAA0226-likeSESPHLTASTDDGDAR
A150D Kiaa0226lUncharacterized protein KIAA0226-likenPKTVATSPSPK
A1514 Lama1Laminin subunit alpha-1LKPLKTLEEnLSR
A1514 Lama1Laminin subunit alpha-1ANLKEEFQEK
A1514 Lama1Laminin subunit alpha-1GcMGEAFLnGK
A1514 Lama1Laminin subunit alpha-1QISInNTAVMqR
A1514 Lama1Laminin subunit alpha-1EANSLLSNHSEK
A1514 Lama1Laminin subunit alpha-1qAASIKVAVSADR
A1514 Lama1Laminin subunit alpha-1KqqGITmK
A1514 Lama1Laminin subunit alpha-1qGLLAVFDAYDTSDK
A1514 Lama1Laminin subunit alpha-1QGETPGAASDLNR
A1514 Lama1Laminin subunit alpha-1QISINNTAVmQR
A1514 Lama1Laminin subunit alpha-1ITATYqPR
A1514 Lama1Laminin subunit alpha-1nLTSqFQESVDNITK
A1514 Lama1Laminin subunit alpha-1TqESnLLLLLVK
A1514 Lama1Laminin subunit alpha-1nGVLLGISSAK
A1514 Lama1Laminin subunit alpha-1LKPLKTLEEnLSR
A1514 Lama1Laminin subunit alpha-1GcMGEAFLnGK
A1514 Lama1Laminin subunit alpha-1EANSLLSNHSEK
A1514 Lama1Laminin subunit alpha-1KqqGITmK
A1514 Lama1Laminin subunit alpha-1qGLLAVFDAYDTSDK
A1514 Lama1Laminin subunit alpha-1QGETPGAASDLNR
A1514 Lama1Laminin subunit alpha-1QISINNTAVmQR
A1514 Lama1Laminin subunit alpha-1TqESnLLLLLVK
A1517 Lamb2Laminin subunit beta-2GQVEQANQELR
A1517 Lamb2Laminin subunit beta-2AQAALDKANASR
A1517 Lamb2Laminin subunit beta-2EQVGDQYQTVR
A1517 Lamb2Laminin subunit beta-2DLLQAAQDK
A1517 Lamb2Laminin subunit beta-2AGNSLAASTAEETAGSAQSR
A1517 Lamb2Laminin subunit beta-2qAEEAqqRAQAALDK
A1517 Lamb2Laminin subunit beta-2VVQDLAAR
A1517 Lamb2Laminin subunit beta-2DGYSQQIVcQcR
A1517 Lamb2Laminin subunit beta-2ADEcDTHTGAcLGcR
A1517 Lamb2Laminin subunit beta-2cEAcAPGHFGDPSKPGGR
A1517 Lamb2Laminin subunit beta-2AMDYDLLLR
A1518 Lamc1Laminin subunit gamma-1TFGEVTDLDNEVNGMLR
A1518 Lamc1Laminin subunit gamma-1AALALQPR
A1518 Lamc1Laminin subunit gamma-1LSAEDLVLEGAGLR
A1518 Lamc1Laminin subunit gamma-1LKDYEDLR
A1518 Lamc1Laminin subunit gamma-1GKAEQQTADQLLAR
A1518 Lamc1Laminin subunit gamma-1LLnNLTSIKIR
A1518 Lamc1Laminin subunit gamma-1LNTFGDEVFnDPKVLK
A1518 Lamc1Laminin subunit gamma-1EAQLALGNAAADATEAK
A1518 Lamc1Laminin subunit gamma-1LNEIEGSLNK
A1518 Lamc1Laminin subunit gamma-1TLPTGcFNTPSIEKP
A1518 Lamc1Laminin subunit gamma-1QLEEAEnELK
A1518 Lamc1Laminin subunit gamma-1LKDYEDLR
A1518 Lamc1Laminin subunit gamma-1EVVcTHcPTGTAGK
A1518 Lamc1Laminin subunit gamma-1QDIAVISDSYFPR
A1518 Lamc1Laminin subunit gamma-1LcRPcQcNDNIDPNAVGNcNR
A1518 Lamc1Laminin subunit gamma-1VSVPLIAQGNSYPSETTVK
A1518 Lamc1Laminin subunit gamma-1TGQcEcQPGITGQHcER
A1518 Lamc1Laminin subunit gamma-1EDGRcEcR
A1518 Lamc1Laminin subunit gamma-1KQEAAImDYNR
A1518 Lamc1Laminin subunit gamma-1AnRGFIR
A1518 Lamc1Laminin subunit gamma-1STGHGGHcTNcR
A1518 Lamc1Laminin subunit gamma-1LLNnLTSIK
A1518 Lamc1Laminin subunit gamma-1LGNTEAcSPcHcSPVGSLSTQcDSYGR
A1518 Lamc1Laminin subunit gamma-1ATAESASEcLPcDcNGR
A1518 Lamc1Laminin subunit gamma-1TREDGPWIPYQYYSGScENTYSK
A1518 Lamc1Laminin subunit gamma-1EGFFGNPLAPNPADK
A1518 Lamc1Laminin subunit gamma-1GKAEQQTADQLLAR
A1518 Lamc1Laminin subunit gamma-1SQEcYFDPELYR
A1518 Lamc1Laminin subunit gamma-1DIHNLEDIKK
A1518 Lamc1Laminin subunit gamma-1SRVESTEQLIEIASR
A1518 Lamc1Laminin subunit gamma-1NTIEETGILAER
A1518 Lamc1Laminin subunit gamma-1TFGEVTDLDNEVNGMLR
A1518 Lamc1Laminin subunit gamma-1AALALQPR
A1518 Lamc1Laminin subunit gamma-1LNTFGDEVFNDPK
A1518 Lamc1Laminin subunit gamma-1LSAEDLVLEGAGLR
A151B Utp14aU3 small nucleolar RNA-associated protein 14 homolog AKEqmISLqnLLTTR
A151B Utp14aU3 small nucleolar RNA-associated protein 14 homolog AEQMISLqnLLTTR
A151C Mup2Major urinary protein 2AGEYSVTYDGFNTFTIPK
A151C Mup2Major urinary protein 2ENIIDLSNANR
A151C Mup2Major urinary protein 2LFLEqIHVLEK
A151C Mup2Major urinary protein 2EPDLSSDIKER
A151C Mup2Major urinary protein 2EKIEDNGNFR
A151C Mup2Major urinary protein 2TDYDNFLMAHLINEK
A151C Mup2Major urinary protein 2LFLEQIHVLEK
A151C Mup2Major urinary protein 2DGETFQLMGLYGR
A151J Wbp2nlPostacrosomal sheath WW domain-binding proteinGALFLTSYRVIFVTSR
A1520 Lamc3Laminin subunit gamma-3LmLmEGWLQR
A1527 Itga8Integrin alpha-8qIPFDTTNnRK
A1527 Itga8Integrin alpha-8mSAGTHcGPPGnR
A1527 Itga8Integrin alpha-8qIPFDTTNnRK
A1527 Itga8Integrin alpha-8qIPFDTTNnRK
A1527 Itga8Integrin alpha-8mSAGTHcGPPGnR
A1529 Mmp272 kDa type IV collagenaseYEScTSAGRNDGK
A1531 Krt8Keratin, type II cytoskeletal 8AqYEDIAnR
A1531 Krt8Keratin, type II cytoskeletal 8LVSESSDVVSK
A1531 Krt8Keratin, type II cytoskeletal 8RqLEALGqEK
A1539 Kng1Kininogen-1REnEFFIVTqTcK
A1539 Kng1Kininogen-1REnEFFIVTqTcK
A1539 Kng1Kininogen-1REnEFFIVTqTcK
A153F PaplIron/zinc purple acid phosphatase-like proteinLAVFGDMGADnPKALPR
A153G Dock6Dedicator of cytokinesis protein 6EHQEDPEmLmDLMYRIAR
A153G Dock6Dedicator of cytokinesis protein 6LSDEDLFK
A153G Dock6Dedicator of cytokinesis protein 6InRTVAAEVR
A153G Dock6Dedicator of cytokinesis protein 6LASmLDSDTEGEGDIGSTINPSVAmAIAGGPLAPGSR
A153G Dock6Dedicator of cytokinesis protein 6LVRLVVRPPIIcGqMVnLGR
A1542 F7Coagulation factor VIIRANSLLEELWPGSLER
A1542 F7Coagulation factor VIIRANSLLEELWPGSLER
A154C Mup5Major urinary protein 5ENIIDLSNANR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinVTSYGGELR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinTcESLGAGGYR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinATFSSVPR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinGMVFGIPDGVLELVPQR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinESLEVQIHPSR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinLcNEcSDGSFHLSK
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinLYQLSPADSGEYVcQVAGSSHPEHEASFK
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteincAPGYYGNPSQGQPcHR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinEADQGAYTcEAMNSR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinLSFSNFAHLGQESFYWQLPEIYQGDK
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteincPIGYSGLScEScDAHFTR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinGSLGTSGETcR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinGHTPTHPGTLNQR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinGTPQDcQPcPcYGAPAAGQAAHTcFLDTDGHPTcDScSPGHSGR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinFRDQIR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinAmLQVHGGSGPR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinATATAcRPcPcPYIDASR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinRcEScAPGYEGNPIQPGGK
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinQPGEVcGPTHFQcVSTNR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinGDKVTSYGGELR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinAMLQVHGGSGPR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinNIGASVEFHcAVPNER
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteincRPTTQEIVR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinGPScQDcDTGYTR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinALSSAGQHVAR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinAFAYLQVPER
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinVAEGQTLDLScVVPGQAHAQVTWHK
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinYELGSGLAVLR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteincFcMGVSR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinAMDFNGILTIR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinFDAGSGMATIR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinLSFDQPNDFK
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinLPAIEPSDQGQYLcR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinIAHVELADAGQYR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinLEPTVPEDSGR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinIEGNTLVIPR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinMASVGLSDIVMDTTVTHTTIHGR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinAmDFNGILTIR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinALEVEEcR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinSYEIIFR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinAQIHnGILR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinEVEQcTcPPGYR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinVPSGLYLGTcER
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinHQGSELHFPSVQPSDAGVYIcTcR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinSVVPQGGPHSLR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinEDGRPLPSSAQQR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinEGQRGSIQVDGEDLVTGR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinNSQLTGGFTVEPVHDGAR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinSQSVRPGADVTFIcTAK
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinDPSPGQPSNFIVPFQEQAWQRPDGQPATR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinQLISTHFAPGDFQGFALVNPQR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinLSGISmDVAVPEnTGqDSAR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinVTSYGGELR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinLLQVTPTDSGEYVcR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinTcESLGAGGYR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinATFSSVPR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinLPQVSPADSGDYVcR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinGMVFGIPDGVLELVPQR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinESLEVQIHPSR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinLcNEcSDGSFHLSK
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinLYQLSPADSGEYVcQVAGSSHPEHEASFK
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteincAPGYYGNPSQGQPcHR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinEADQGAYTcEAMNSR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinLSFSNFAHLGQESFYWQLPEIYQGDK
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteincPIGYSGLScEScDAHFTR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinEGGSLPPQAR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinGSLGTSGETcR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinGHTPTHPGTLNQR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinGTPQDcQPcPcYGAPAAGQAAHTcFLDTDGHPTcDScSPGHSGR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinFRDQIR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinHQIVGSR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinAmLQVHGGSGPR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinATATAcRPcPcPYIDASR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinRcEScAPGYEGNPIQPGGK
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinQPGEVcGPTHFQcVSTNR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinGDKVTSYGGELR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinAMLQVHGGSGPR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinNIGASVEFHcAVPNER
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteincRPTTQEIVR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinGPScQDcDTGYTR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinALSSAGQHVAR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinAFAYLQVPER
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinVAEGQTLDLScVVPGQAHAQVTWHK
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinYELGSGLAVLR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteincFcMGVSR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinIESSSSHVSEGQSLDLNcLVSGQTHPQISWHK
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinAMDFNGILTIR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinFDAGSGMATIR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinLSFDQPNDFK
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinLPAIEPSDQGQYLcR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinIAHVELADAGQYR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinLEPTVPEDSGR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinIEGNTLVIPR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinMASVGLSDIVMDTTVTHTTIHGR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinAmDFNGILTIR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinVSGISMDVAVPENTGQDSAR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinALEVEEcR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinSYEIIFR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinAQIHnGILR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinEVEQcTcPPGYR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinVPSGLYLGTcER
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinHQGSELHFPSVQPSDAGVYIcTcR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinSVVPQGGPHSLR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinLYILQASPADAGEYVcR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinLHQVSPVDSGEYVcR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinEDGRPLPSSAQQR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinAASISAVSLEVAQPGPSSGPR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinEGQRGSIQVDGEDLVTGR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinNSQLTGGFTVEPVHDGAR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinSQSVRPGADVTFIcTAK
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinDPSPGQPSNFIVPFQEQAWQRPDGQPATR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinQLISTHFAPGDFQGFALVNPQR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinAELLVAEAPSKPITVTVEEQR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinVTSYGGELR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinTcESLGAGGYR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinATFSSVPR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinLPQVSPADSGDYVcR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinGMVFGIPDGVLELVPQR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinESLEVQIHPSR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinLcNEcSDGSFHLSK
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteincAPGYYGNPSQGQPcHR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinEADQGAYTcEAMNSR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinEGGSLPPQAR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinGHTPTHPGTLNQR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinATATAcRPcPcPYIDASR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinRcEScAPGYEGNPIQPGGK
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinQPGEVcGPTHFQcVSTNR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinGDKVTSYGGELR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinAMLQVHGGSGPR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinGPScQDcDTGYTR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteincFcMGVSR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinLPAIEPSDQGQYLcR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinMASVGLSDIVMDTTVTHTTIHGR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinVSGISMDVAVPENTGQDSAR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinALEVEEcR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinSYEIIFR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinAQIHnGILR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinEVEQcTcPPGYR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinVPSGLYLGTcER
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinHQGSELHFPSVQPSDAGVYIcTcR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinLYILQASPADAGEYVcR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinEDGRPLPSSAQQR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinAASISAVSLEVAQPGPSSGPR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinEGQRGSIQVDGEDLVTGR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinNSQLTGGFTVEPVHDGAR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinSQSVRPGADVTFIcTAK
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinDPSPGQPSNFIVPFQEQAWQRPDGQPATR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinQLISTHFAPGDFQGFALVNPQR
A1555 Hspg2Basement membrane-specific heparan sulfate proteoglycan core proteinAELLVAEAPSKPITVTVEEQR
A1558 Ephb6Ephrin type-B receptor 6LPQELGGR
A1558 Ephb6Ephrin type-B receptor 6LPQELGGR
A1558 Ephb6Ephrin type-B receptor 6AALLGqFqHPNILR
A1559 Lama4Laminin subunit alpha-4DKIQEInSK
A1559 Lama4Laminin subunit alpha-4HFVIDSRPVSFSK
A1559 Lama4Laminin subunit alpha-4QLqAAER
A1559 Lama4Laminin subunit alpha-4EYmGLAIKnDnLVYVYNLGmK
A1559 Lama4Laminin subunit alpha-4LAFTqSR
A1559 Lama4Laminin subunit alpha-4TVEqKRPASnISASIqR
A155I Rnf166RING finger protein 166LPFDPKK
A155I Rnf166RING finger protein 166mAmFRSLVASAqqR
A156C MvpMajor vault proteinAqQLADVEAK
A156C MvpMajor vault proteinmATEEAIIR
A1577 Krt18Keratin, type I cytoskeletal 18SLETEnRR
A1577 Krt18Keratin, type I cytoskeletal 18IVLQIDNAR
A1577 Krt18Keratin, type I cytoskeletal 18SQDLSKImADIR
A1577 Krt18Keratin, type I cytoskeletal 18VVDDTNITR
A1577 Krt18Keratin, type I cytoskeletal 18QSVESDIHGLR
A1577 Krt18Keratin, type I cytoskeletal 18STTFSTNYR
A1577 Krt18Keratin, type I cytoskeletal 18LAADDFR
A157B Utp20Small subunit processome component 20 homologIIEDLGVHFLqYVLK
A157B Utp20Small subunit processome component 20 homologTLEEQmGnVK
A157B Utp20Small subunit processome component 20 homologALYLESK
A157B Utp20Small subunit processome component 20 homologADLFPILmR
A157B Utp20Small subunit processome component 20 homologEILqnTTSLK
A157B Utp20Small subunit processome component 20 homologLAISAqNEPAR
A157B Utp20Small subunit processome component 20 homologQLQVLLAYAEEDIYDTSR
A157B Utp20Small subunit processome component 20 homologHFIHVLqSGQINqK
A157B Utp20Small subunit processome component 20 homologKEEPSKPATLmWLIqK
A1584 Col4a1Collagen alpha-1(IV) chainGDKGDVGLPGmPGSmEHVDmGSMK
A1584 Col4a1Collagen alpha-1(IV) chainHSQTTDDPLcPPGTK
A1584 Col4a1Collagen alpha-1(IV) chainAHGQDLGTAGScLR
A1584 Col4a1Collagen alpha-1(IV) chainSAPFIEcHGR
A1584 Col4a1Collagen alpha-1(IV) chainGDPGFPGQPGmPGRAGTPGR
A1585 Nid1Nidogen-1AEcLNPAQPGR
A1585 Nid1Nidogen-1VLFDTGLVNPR
A1585 Nid1Nidogen-1VIIGLAFDcVDK
A1585 Nid1Nidogen-1SFQLPAER
A1585 Nid1Nidogen-1ASLHGGEPTTIIR
A1585 Nid1Nidogen-1TIFWTDSQLDR
A158B Utp23rRNA-processing protein UTP23 homologIqLRDqLPR
A158B Utp23rRNA-processing protein UTP23 homologQSIKqLK
A158B Utp23rRNA-processing protein UTP23 homologAVEAGqLVSVHEK
A158B Utp23rRNA-processing protein UTP23 homologIqLRDqLPR
A158B Utp23rRNA-processing protein UTP23 homologQSIKqLK
A158B Utp23rRNA-processing protein UTP23 homologAVEAGqLVSVHEK
A1599 CfhComplement factor HKIQIMR
A1599 CfhComplement factor HmVqHRFLLESVGPR
A1599 CfhComplement factor HcVATDQLEK
A1601 C1sbComplement C1s-B subcomponentTqSNTLGIVFQTDLMGQK
A1601 C1sbComplement C1s-B subcomponentESTAnSNWEPDK
A1601 C1sbComplement C1s-B subcomponentVIIHPGWK
A1601 C1sbComplement C1s-B subcomponentWVnDqLGIELPR
A1602 CfbComplement factor BKqGISEFYADDIALLK
A1602 CfbComplement factor BVKDASEVVTPR
A1602 CfbComplement factor BLGMETSAWKEIR
A1602 CfbComplement factor BYPSPAWRK
A1602 CfbComplement factor BKqGISEFYADDIALLK
A1602 CfbComplement factor BVKDASEVVTPR
A1602 CfbComplement factor BLGMETSAWKEIR
A160G Dpcr1Diffuse panbronchiolitis critical region protein 1 homologSTTSENGSDGKR
A160G Dpcr1Diffuse panbronchiolitis critical region protein 1 homologqSSSPVYATETPR
A161J Wdr92WD repeat-containing protein 92EDPVANMEPAqGENKR
A162F IFI44LInterferon-induced protein 44-likeLLGNASLTLLYQSSAHK
A162F IFI44LInterferon-induced protein 44-likeLLGNASLTLLYQSSAHK
A162J Wdr93WD repeat-containing protein 93YSIMLQK
A1632 LcatPhosphatidylcholine-sterol acyltransferaseQSqPVHLLPMNETDHLNMVFSNK
A1639 Runx2Runt-related transcription factor 2nASAVmKNQVAR
A1639 Runx2Runt-related transcription factor 2nASAVmKNQVAR
A1639 Runx2Runt-related transcription factor 2nQVARFNDLR
A1639 Runx2Runt-related transcription factor 2nASAVmKNQVAR
A1639 Runx2Runt-related transcription factor 2nQVARFNDLR
A1639 Runx2Runt-related transcription factor 2nASAVmKNQVAR
A1639 Runx2Runt-related transcription factor 2nASAVmKNQVAR
A1639 Runx2Runt-related transcription factor 2nQVARFNDLR
A1639 Runx2Runt-related transcription factor 2QFPSISSLTES
A1646 Trim29Tripartite motif-containing protein 29SqVPKAqPqTWK
A1652 Mmp1aInterstitial collagenase ANVnGKEmMAEK
A1652 Mmp1aInterstitial collagenase AYLEnYYnLGKnMQAK
A166B Wdfy3WD repeat and FYVE domain-containing protein 3LmVTEIRR
A166B Wdfy3WD repeat and FYVE domain-containing protein 3EPVGqIVcTDKGILAVEQNK
A166B Wdfy3WD repeat and FYVE domain-containing protein 3VSLPVNDR
A166B Wdfy3WD repeat and FYVE domain-containing protein 3TVPqQVALLDSLR
A166B Wdfy3WD repeat and FYVE domain-containing protein 3qNGTKLGDVILPPWAK
A166B Wdfy3WD repeat and FYVE domain-containing protein 3TNINLqAcEELVR
A166B Wdfy3WD repeat and FYVE domain-containing protein 3VSLPVNDR
A1670 Col4a2Collagen alpha-2(IV) chainGDAGMSGERGHPGSPGFK
A1670 Col4a2Collagen alpha-2(IV) chainATPFIEcNGGR
A1670 Col4a2Collagen alpha-2(IV) chainHSQTDQEPmcPVGMNK
A1670 Col4a2Collagen alpha-2(IV) chainIAVQPGTLGPQGR
A1670 Col4a2Collagen alpha-2(IV) chainAHNQDLGLAGScLAR
A1670 Col4a2Collagen alpha-2(IV) chainGLSGDRGDAGmSGER
A1670 Col4a2Collagen alpha-2(IV) chainGLDGFQGPSGPR
A1670 Col4a2Collagen alpha-2(IV) chainGqPGAVGPQGYnGPPGLQGFPGLQGR
A1671 Col4a3Collagen alpha-3(IV) chainVISLPGSPGPPGVPGQPGmK
A1672 Col4a4Collagen alpha-4(IV) chainGDmVISR
A1672 Col4a4Collagen alpha-4(IV) chainAAPFVEcQGR
A1672 Col4a4Collagen alpha-4(IV) chainGDPGRDGLPGLHR
A1686 ItgamIntegrin alpha-MYVIGVGnAFNKPQSR
A1686 ItgamIntegrin alpha-MEnFGTWEPHTSIKGSqR
A1686 ItgamIntegrin alpha-MKDSASqNPLTK
A1686 ItgamIntegrin alpha-MVTFINTTR
A1687 ItgaxIntegrin alpha-XmLDFVK
A1687 ItgaxIntegrin alpha-XVLIVITDGR
A168C Myo15aUnconventional myosin-XVIILLqSR
A168C Myo15aUnconventional myosin-XVAEPGRFAVVmPqVR
A168C Myo15aUnconventional myosin-XVGLFSSVPAR
A168C Myo15aUnconventional myosin-XVqAVLLAR
A168C Myo15aUnconventional myosin-XVcLAAMnQR
A168C Myo15aUnconventional myosin-XVVTETIREK
A1693 Itga7Integrin alpha-7VEPSTSWWPVSSAEK
A1693 Itga7Integrin alpha-7IcqSnLqLER
A1693 Itga7Integrin alpha-7DSASRLIPEVVLSGER
A1693 Itga7Integrin alpha-7VEPSTSWWPVSSAEK
A1693 Itga7Integrin alpha-7IcqSnLqLER
A1694 Itga1Integrin alpha-1DVAVVKVTMNFEPnK
A1694 Itga1Integrin alpha-1IPSGGDGKTLK
A1694 Itga1Integrin alpha-1SFFSGTQER
A1694 Itga1Integrin alpha-1TGDVVNFK
A1694 Itga1Integrin alpha-1VMVIVTDGESHDNYR
A1694 Itga1Integrin alpha-1YSSTEEVLVAANK
A1694 Itga1Integrin alpha-1QVIQDcEDENIQR
A169C Myo16Unconventional myosin-XVIGDnDqLASPGFPVFnGPSR
A169C Myo16Unconventional myosin-XVIGqGAAFTVmHYAGR
A169C Myo16Unconventional myosin-XVIGDnDqLASPGFPVFnGPSR
A169C Myo16Unconventional myosin-XVIGqGAAFTVmHYAGR
A169G Dpp8Dipeptidyl peptidase 8cPIKEEITITSGEWEVLGR
A170I Rnasel2-5A-dependent ribonucleaseWMGESQmVRR
A170I Rnasel2-5A-dependent ribonucleaseDnMGRnALIR
A171G Dppa4Developmental pluripotency-associated protein 4ILTKSLEG
A171G Dppa4Developmental pluripotency-associated protein 4AFPEQLLELR
A1723 Gipc2PDZ domain-containing protein GIPC2VEDFSSISELYAK
A1723 Gipc2PDZ domain-containing protein GIPC2IKDGSTIDSVK
A1723 Gipc2PDZ domain-containing protein GIPC2SSGSQGVPGPPAPAR
A1723 Gipc2PDZ domain-containing protein GIPC2DIDLATTMFEAGKDK
A1723 Gipc2PDZ domain-containing protein GIPC2SKGPATVEELPSEAK
A1727 Map3k9Mitogen-activated protein kinase kinase kinase 9SLVDGYK
A1727 Map3k9Mitogen-activated protein kinase kinase kinase 9SLVDGYKqWSSSAPNLGK
A1732 Krit1Krev interaction trapped protein 1HGnnTTAqqIMEGMR
A1732 Krit1Krev interaction trapped protein 1qGFLNEETLK
A1732 Krit1Krev interaction trapped protein 1DAINKPYEK
A1732 Krit1Krev interaction trapped protein 1HGnnTTAqqIMEGMR
A1732 Krit1Krev interaction trapped protein 1SmSSVVEDKER
A1732 Krit1Krev interaction trapped protein 1qGFLNEETLK
A1732 Krit1Krev interaction trapped protein 1DAINKPYEK
A1732 Krit1Krev interaction trapped protein 1LLmKLnGqLMPSER
A1732 Krit1Krev interaction trapped protein 1qAGLVVKLLmK
A1732 Krit1Krev interaction trapped protein 1HGnnTTAqqIMEGMR
A1732 Krit1Krev interaction trapped protein 1qGFLNEETLK
A1732 Krit1Krev interaction trapped protein 1DAINKPYEK
A1732 Krit1Krev interaction trapped protein 1LLmKLnGqLMPSER
A173C Myo1eUnconventional myosin-IeVIqKTWR
A173C Myo1eUnconventional myosin-IeWTPIEYFnnK
A1740 Cd163Scavenger receptor cysteine-rich type 1 protein M130ESEVPcIASGQLR
A174B WibgPartner of Y14 and magoIQAGEVSQPSR
A1760 Runx3Runt-related transcription factor 3nASAVmKNQVAR
A176C Myo5bUnconventional myosin-VbLTnENLDFK
A176C Myo5bUnconventional myosin-VbAGQVAYLEK
A176C Myo5bUnconventional myosin-VbNQSIIVSGESGAGK
A176C Myo5bUnconventional myosin-VbLnVGmEnK
A176C Myo5bUnconventional myosin-VbLQAqLEK
A176C Myo5bUnconventional myosin-VbGQqDSKK
A176C Myo5bUnconventional myosin-VbTSLnLLmETLNATTPHYVR
A176C Myo5bUnconventional myosin-VbNDLnELRK
A176C Myo5bUnconventional myosin-VbSRYqNLVK
A176H Lrrc10Leucine-rich repeat-containing protein 10WAEETPEPDPRK
A176H Lrrc10Leucine-rich repeat-containing protein 10TLWLESNcLTRLPDVVcELSLLK
A177B Ybx1Nuclease-sensitive element-binding protein 1NDTKEDVFVHQTAIK
A177B Ybx1Nuclease-sensitive element-binding protein 1RPQYSNPPVQGEVMEGADNQGAGEQGRPVR
A177B Ybx1Nuclease-sensitive element-binding protein 1GAEAANVTGPGGVPVQGSK
A177B Ybx1Nuclease-sensitive element-binding protein 1EDGNEEDKENQGDETQGQQPPQR
A177B Ybx1Nuclease-sensitive element-binding protein 1AADPPAENSSAPEAEQGGAE
A177B Ybx1Nuclease-sensitive element-binding protein 1NGYGFINR
A177B Ybx1Nuclease-sensitive element-binding protein 1RPQYSNPPVQGEVMEGADNQGAGEQGRPVR
A177B Ybx1Nuclease-sensitive element-binding protein 1GAEAANVTGPGGVPVQGSK
A177B Ybx1Nuclease-sensitive element-binding protein 1EDGNEEDKENQGDETQGQQPPQR
A177B Ybx1Nuclease-sensitive element-binding protein 1AADPPAENSSAPEAEQGGAE
A1786 Ccr8C-C chemokine receptor type 8ILqQLR
A178B Ybx2Y-box-binding protein 2NDTKEDVFVHQTAIK
A178B Ybx2Y-box-binding protein 2NGYGFINR
A178B Ybx2Y-box-binding protein 2NDTKEDVFVHQTAIK
A178B Ybx2Y-box-binding protein 2TPGNqATAASGTPAPPAR
A178B Ybx2Y-box-binding protein 2NGYGFINR
A178B Ybx2Y-box-binding protein 2SqADKPVLAIQVLGTVK
A178B Ybx2Y-box-binding protein 2NDTKEDVFVHQTAIK
A178B Ybx2Y-box-binding protein 2NGYGFINR
A178B Ybx2Y-box-binding protein 2SqADKPVLAIQVLGTVK
A178C Myo7aUnconventional myosin-VIIaKELLEQMEK
A178C Myo7aUnconventional myosin-VIIaDQccIISGESGAGK
A178C Myo7aUnconventional myosin-VIIaGTDATMLHKLnSQHK
A178C Myo7aUnconventional myosin-VIIaKELLEQMEK
A178C Myo7aUnconventional myosin-VIIaDQccIISGESGAGK
A178C Myo7aUnconventional myosin-VIIaGTDATMLHKLnSQHK
A178C Myo7aUnconventional myosin-VIIaDQccIISGESGAGK
A179B Yeats2YEATS domain-containing protein 2IDIIHnLKLDR
A179B Yeats2YEATS domain-containing protein 2IVPqSqVPNPESPGK
A179B Yeats2YEATS domain-containing protein 2TFDPmAFnHPAIKK
A179B Yeats2YEATS domain-containing protein 2IVPqSQVPNPESPGK
A179B Yeats2YEATS domain-containing protein 2IDIIHnLKLDR
A179B Yeats2YEATS domain-containing protein 2IVPqSqVPNPESPGK
A179B Yeats2YEATS domain-containing protein 2TFDPmAFnHPAIKK
A179B Yeats2YEATS domain-containing protein 2IVPqSQVPNPESPGK
A179I Rnf6E3 ubiquitin-protein ligase RNF6LEPIRLRPAFSSR
A179I Rnf6E3 ubiquitin-protein ligase RNF6SQTSMSSSGPRGR
A179I Rnf6E3 ubiquitin-protein ligase RNF6SQTSMSSSGPR
A179I Rnf6E3 ubiquitin-protein ligase RNF6LEPIRLRPAFSSR
A179I Rnf6E3 ubiquitin-protein ligase RNF6SQTSMSSSGPR
A1804 Ren1Renin-1FYTEFDRHNnR
A1804 Ren1Renin-1TDSWQITMK
A1804 Ren1Renin-1LIMQALGAK
A1804 Ren1Renin-1LImqALGAK
A1805 AceAngiotensin-converting enzymeYVEFSnKIAK
A1805 AceAngiotensin-converting enzymeLLADAMK
A1805 AceAngiotensin-converting enzymeEAGHQGPLHQcDIYQSAQAGAK
A1805 AceAngiotensin-converting enzymeVFDGSITK
A1805 AceAngiotensin-converting enzymeYQGIcPPVAR
A1805 AceAngiotensin-converting enzymeDLHVSLR
A1805 AceAngiotensin-converting enzymeGPQFGSEVELR
A1805 AceAngiotensin-converting enzymeSLYESDNLEQDLEK
A1805 AceAngiotensin-converting enzymeSMLEKPTDGR
A1805 AceAngiotensin-converting enzymeQDDFSDTGAFWR
A1805 AceAngiotensin-converting enzymeHGETLGWPEYNWAPNTAR
A1805 AceAngiotensin-converting enzymeLNGYTDAGDSWR
A1805 AceAngiotensin-converting enzymeRQEEAALVSQEFAEVWGK
A1805 AceAngiotensin-converting enzymeFVEEYDR
A180B YLPM1YLP motif-containing protein 1MDWERER
A180B YLPM1YLP motif-containing protein 1DqDmDEGYGREmDR
A180B YLPM1YLP motif-containing protein 1MDWERER
A180B YLPM1YLP motif-containing protein 1DqDmDEGYGREmDR
A1812 Map3k13Mitogen-activated protein kinase kinase kinase 13IIHRDLK
A1815 MttpMicrosomal triglyceride transfer protein large subunitAIPIVGqVLERVcK
A1815 MttpMicrosomal triglyceride transfer protein large subunitLELKTTEAGPR
A1815 MttpMicrosomal triglyceride transfer protein large subunitnILLSIGELPK
A1819 B2mBeta-2-microglobulinTPQIQVYSR
A1823 H2-D1H-2 class I histocompatibility antigen, D-K alpha chainTYLEGPcKDSLLR
A1823 H2-D1H-2 class I histocompatibility antigen, D-K alpha chainTYLEGPcKDSLLR
A1823 H2-D1H-2 class I histocompatibility antigen, D-K alpha chainTYLEGPcKDSLLR
A1839 Tap2Antigen peptide transporter 2QLWWRR
A1839 Tap2Antigen peptide transporter 2DGqDVYAHLVqQR
A183C N4bp3NEDD4-binding protein 3AQAQAQDAELARLR
A184D Commd10COMM domain-containing protein 10mAASAALILPESPSMKK
A184I Rnaseh2bRibonuclease H2 subunit BmcLQqLFEIKVFK
A184I Rnaseh2bRibonuclease H2 subunit BmcLQQLFEIKVFK
A184I Rnaseh2bRibonuclease H2 subunit BYqPLDQVVVD
A1856 Mpp4MAGUK p55 subfamily member 4qVLQAPHcK
A186D  UPF0585 protein C16orf13 homologcLDSIAATTR
A186D  UPF0585 protein C16orf13 homologAQGLSNVK
A186D  UPF0585 protein C16orf13 homologISPQSNVDFDLTLR
A186D  UPF0585 protein C16orf13 homologQYVDPAQR
A186D  UPF0585 protein C16orf13 homologDTVLLEELGQASGLVLER
A186D  UPF0585 protein C16orf13 homologMVDMPANNK
A186D  UPF0585 protein C16orf13 homologMVDMPAnNKcLIFR
A186D  UPF0585 protein C16orf13 homologDTVLLEELGQASGLVLER
A186D  UPF0585 protein C16orf13 homologMVDMPANNK
A186D  UPF0585 protein C16orf13 homologcLDSIAATTR
A186D  UPF0585 protein C16orf13 homologAQGLSNVK
A186D  UPF0585 protein C16orf13 homologISPQSNVDFDLTLR
A186D  UPF0585 protein C16orf13 homologQYVDPAQR
A186D  UPF0585 protein C16orf13 homologDTVLLEELGQASGLVLER
A1876 Abcc9ATP-binding cassette sub-family C member 9NGLFSTLVMTnK
A1876 Abcc9ATP-binding cassette sub-family C member 9LPIAmRAVTNYVcLK
A1876 Abcc9ATP-binding cassette sub-family C member 9NGLFSTLVMTnK
A1876 Abcc9ATP-binding cassette sub-family C member 9LPIAmRAVTNYVcLK
A1876 Abcc9ATP-binding cassette sub-family C member 9NGLFSTLVMTnK
A1889 Cldn8Claudin-8YSVPSHR
A188C Slc24a4Sodium/potassium/calcium exchanger 4IIINERQR
A188C Slc24a4Sodium/potassium/calcium exchanger 4IIINERQR
A188C Slc24a4Sodium/potassium/calcium exchanger 4KLGIYVLVLYAVFLcFSIMIEFnVFTFVnLPMcR
A190A Wnt6Protein Wnt-6VLQQDIR
A190A Wnt6Protein Wnt-6VLQQDIR
A1914 Ctnna2Catenin alpha-2EYAQVFREHANK
A1914 Ctnna2Catenin alpha-2EYAQVFREHAnK
A1914 Ctnna2Catenin alpha-2EYAQVFR
A1914 Ctnna2Catenin alpha-2IVAEcNAVR
A1914 Ctnna2Catenin alpha-2nATnEqDLAnRFK
A1914 Ctnna2Catenin alpha-2TSVQTEDDQLIAGQSAR
A1914 Ctnna2Catenin alpha-2LESIISGAALMADSScTR
A1914 Ctnna2Catenin alpha-2IVAEcNAVR
A1914 Ctnna2Catenin alpha-2nATnEqDLAnRFK
A1914 Ctnna2Catenin alpha-2LESIISGAALMADSScTR
A1922 Epb42Erythrocyte membrane protein band 4.2GLIHREK
A1927 Dnm2Dynamin-2GMEELIPLVNK
A1927 Dnm2Dynamin-2DVEKGFMSnK
A1927 Dnm2Dynamin-2FPFELVK
A1927 Dnm2Dynamin-2GMEELIPLVNK
A1927 Dnm2Dynamin-2DVEKGFMSnK
A1927 Dnm2Dynamin-2GYIGVVnRSQK
A1927 Dnm2Dynamin-2FPFELVK
A1927 Dnm2Dynamin-2DLMPKTIMHLmInnTK
A1928 Dnm3Dynamin-3GYVGVVnR
A1928 Dnm3Dynamin-3FPFEIVK
A1928 Dnm3Dynamin-3GYVGVVnR
A1928 Dnm3Dynamin-3FPFEIVK
A1929 Dnm1lDynamin-1-like proteinYIETSELcGGAR
A1929 Dnm1lDynamin-1-like proteinYIETSELcGGAR
A1930 Pvrl2Poliovirus receptor-related protein 2TPYFDAGVScADqEmPR
A1940 PrkczProtein kinase C zeta typeKNDQIYAmK
A1940 PrkczProtein kinase C zeta typeDLKLDNVLLDADGHIK
A1957 GSTM4Glutathione S-transferase Mu 4LYSEFLGK
A1957 GSTM4Glutathione S-transferase Mu 4SQWLSEK
A1987 GabrdGamma-aminobutyric acid receptor subunit deltaSAGQFPRLSLHFQLR
A1987 GabrdGamma-aminobutyric acid receptor subunit deltaLQLAQFTITSYR
A1987 GabrdGamma-aminobutyric acid receptor subunit deltaLqLAqFTITSYR
A198C Ndufa6NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6MELQETIK
A198C Ndufa6NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6GKMELQETIK
A198C Ndufa6NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6AWYREVPnTVHLmQLDITVK
A198C Ndufa6NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6EVPNTVHLMQLDITVK
A198C Ndufa6NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6mAAAATGLR
A198C Ndufa6NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6FFHETETPRPK
A198C Ndufa6NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6QRTHVmR
A198C Ndufa6NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6QAAAAAASTSVKPIFSR
A198C Ndufa6NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6VVDLLVIK
A200B Zc3h3Zinc finger CCCH domain-containing protein 3LRPAITGGGK
A200B Zc3h3Zinc finger CCCH domain-containing protein 3SGAINASGVqR
A200B Zc3h3Zinc finger CCCH domain-containing protein 3mEEKEQLR
A200B Zc3h3Zinc finger CCCH domain-containing protein 3qMSSGLASGAEAPASPPPSPR
A200B Zc3h3Zinc finger CCCH domain-containing protein 3qVqLSPDQnMVIK
A2012 Tm7sf2Delta(14)-sterol reductaseqLLVSGWWGMVR
A2012 Tm7sf2Delta(14)-sterol reductaseAWqEYcKR
A2012 Tm7sf2Delta(14)-sterol reductaseqLLVSGWWGMVR
A2012 Tm7sf2Delta(14)-sterol reductaseAWqEYcKR
A2018 Kdm4dLysine-specific demethylase 4DRGqDqAVVDHTETMVSTSqELTTR
A201B Zc3h4Zinc finger CCCH domain-containing protein 4TAEPASDTSAqPK
A2029 Arid4bAT-rich interactive domain-containing protein 4BKDNILVR
A2029 Arid4bAT-rich interactive domain-containing protein 4BVKEESETEIK
A2029 Arid4bAT-rich interactive domain-containing protein 4BEVNVEDSKNVmPK
A2029 Arid4bAT-rich interactive domain-containing protein 4BVHTDLVIAK
A2029 Arid4bAT-rich interactive domain-containing protein 4BKDNILVR
A2029 Arid4bAT-rich interactive domain-containing protein 4BNSDTAHIK
A2029 Arid4bAT-rich interactive domain-containing protein 4BVKEESETEIK
A2029 Arid4bAT-rich interactive domain-containing protein 4BYSPKncK
A2029 Arid4bAT-rich interactive domain-containing protein 4BEVNVEDSKNVmPK
A2029 Arid4bAT-rich interactive domain-containing protein 4BVHTDLVIAK
A2029 Arid4bAT-rich interactive domain-containing protein 4BKDNILVR
A2029 Arid4bAT-rich interactive domain-containing protein 4BNSDTAHIK
A2029 Arid4bAT-rich interactive domain-containing protein 4BVKEESETEIK
A2029 Arid4bAT-rich interactive domain-containing protein 4BYSPKncK
A2029 Arid4bAT-rich interactive domain-containing protein 4BEVNVEDSKNVmPK
A202B Zc3h6Zinc finger CCCH domain-containing protein 6LVWDPKK
A202J Xrcc3DNA repair protein XRCC3VLSALHLFqqK
A202J Xrcc3DNA repair protein XRCC3VLSALHLFqqK
A2040 CHD6Chromodomain-helicase-DNA-binding protein 6AFEGTPAR
A2040 CHD6Chromodomain-helicase-DNA-binding protein 6QmIQQYEMVYR
A2040 CHD6Chromodomain-helicase-DNA-binding protein 6WATMEELEK
A2040 CHD6Chromodomain-helicase-DNA-binding protein 6ncILADEMGLGK
A2040 CHD6Chromodomain-helicase-DNA-binding protein 6HDRDLLIGTAK
A2040 CHD6Chromodomain-helicase-DNA-binding protein 6QmIQQYEMVYR
A2040 CHD6Chromodomain-helicase-DNA-binding protein 6WATMEELEK
A2041 Chd7Chromodomain-helicase-DNA-binding protein 7SEESSqPEAGAVSRGK
A2041 Chd7Chromodomain-helicase-DNA-binding protein 7ncILADEMGLGK
A2041 Chd7Chromodomain-helicase-DNA-binding protein 7ccnHPYLInGAEEKILEEFK
A2041 Chd7Chromodomain-helicase-DNA-binding protein 7SDDYLPSIEqqPqqK
A204A Aebp1Adipocyte enhancer-binding protein 1WTVEKnK
A204H Lrrc2Leucine-rich repeat-containing protein 2NKLTYLPqAMLnLK
A2050 Ino80DNA helicase INO80SAIDEnqLSR
A2050 Ino80DNA helicase INO80AALqAQKNcK
A2050 Ino80DNA helicase INO80KHLSIEqLNAR
A2050 Ino80DNA helicase INO80WQYMVLDEAqALK
A2050 Ino80DNA helicase INO80RAALqAqK
A2050 Ino80DNA helicase INO80AEKEALEQR
A2050 Ino80DNA helicase INO80RSATSSLR
A2050 Ino80DNA helicase INO80SAIDEnqLSR
A2050 Ino80DNA helicase INO80AALqAQKNcK
A2050 Ino80DNA helicase INO80KHLSIEqLNAR
A2050 Ino80DNA helicase INO80GNLYnFSK
A2050 Ino80DNA helicase INO80RAALqAqK
A2050 Ino80DNA helicase INO80AEKEALEQR
A2050 Ino80DNA helicase INO80RSATSSLR
A2052 Ep400E1A-binding protein p400DYqKIGLDWLAK
A2052 Ep400E1A-binding protein p400ERISEDLVmASmK
A2052 Ep400E1A-binding protein p400VKGmTER
A2052 Ep400E1A-binding protein p400IAqLASIAGPqSR
A2052 Ep400E1A-binding protein p400LEALAILLqK
A2052 Ep400E1A-binding protein p400RqqVmPPTEqSK
A2052 Ep400E1A-binding protein p400IcnHPGLVEPR
A2052 Ep400E1A-binding protein p400LVqFDSGK
A2052 Ep400E1A-binding protein p400LAEqITLENQIHQRIADLR
A2052 Ep400E1A-binding protein p400EIEYFWSnIEQVVEIKLqVELEEK
A2052 Ep400E1A-binding protein p400DYqKIGLDWLAK
A2052 Ep400E1A-binding protein p400ERISEDLVmASmK
A2052 Ep400E1A-binding protein p400VKGmTER
A2052 Ep400E1A-binding protein p400IAqLASIAGPqSR
A2052 Ep400E1A-binding protein p400RqqVmPPTEqSK
A2052 Ep400E1A-binding protein p400LAGTqQVQTqIQVAK
A2052 Ep400E1A-binding protein p400IcnHPGLVEPR
A2052 Ep400E1A-binding protein p400ISEDLVmASMK
A2052 Ep400E1A-binding protein p400LAEqITLENQIHQRIADLR
A2052 Ep400E1A-binding protein p400EIEYFWSnIEQVVEIKLqVELEEK
A2052 Ep400E1A-binding protein p400DYqKIGLDWLAK
A2052 Ep400E1A-binding protein p400ERISEDLVmASmK
A2052 Ep400E1A-binding protein p400VKGmTER
A2052 Ep400E1A-binding protein p400IAqLASIAGPqSR
A2052 Ep400E1A-binding protein p400LEALAILLqK
A2052 Ep400E1A-binding protein p400IcnHPGLVEPR
A2052 Ep400E1A-binding protein p400LVqFDSGK
A2052 Ep400E1A-binding protein p400ISEDLVmASMK
A2052 Ep400E1A-binding protein p400LAEqITLENQIHQRIADLR
A2052 Ep400E1A-binding protein p400EIEYFWSnIEQVVEIKLqVELEEK
A2056 HltfHelicase-like transcription factornAIKVNNVnGNQVGHIK
A2056 HltfHelicase-like transcription factornAIKVNNVnGNQVGHIK
A205C Ndufb2NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrialYREFPQLTR
A2062 AtrxTranscriptional regulator ATRXVVDQQQVER
A2062 AtrxTranscriptional regulator ATRXWIRnIDYYR
A2062 AtrxTranscriptional regulator ATRXGMYQSVAGGMqPPPLQR
A2062 AtrxTranscriptional regulator ATRXQQmLINcVQR
A2062 AtrxTranscriptional regulator ATRXQQMLINcVqR
A2062 AtrxTranscriptional regulator ATRXQSLSFRVVDQQQVER
A2062 AtrxTranscriptional regulator ATRXnEASAVSKAMNSIK
A2062 AtrxTranscriptional regulator ATRXQQMLIncVQRILMnR
A2062 AtrxTranscriptional regulator ATRXRAEHWSGNK
A2069 Tulp4Tubby-related protein 4ALGLLLnR
A206H LRRD1Leucine-rich repeat and death domain-containing protein 1ELRLLnLDK
A206H LRRD1Leucine-rich repeat and death domain-containing protein 1SDnFTVnLDAK
A206H LRRD1Leucine-rich repeat and death domain-containing protein 1ALnMIGAYDImDK
A206H LRRD1Leucine-rich repeat and death domain-containing protein 1IEnFKELR
A206H LRRD1Leucine-rich repeat and death domain-containing protein 1DSnQIYEANPSK
A2074 Pafah1b1Platelet-activating factor acetylhydrolase IB subunit alphaLNEAKEEFTSGGPLGQK
A2074 Pafah1b1Platelet-activating factor acetylhydrolase IB subunit alphaMVRPNQDGTLIAScSNDQTVR
A2074 Pafah1b1Platelet-activating factor acetylhydrolase IB subunit alphaTAPYVVTGSVDQTVK
A2074 Pafah1b1Platelet-activating factor acetylhydrolase IB subunit alphaLNEAKEEFTSGGPLGQK
A2074 Pafah1b1Platelet-activating factor acetylhydrolase IB subunit alphaMVRPNQDGTLIAScSNDQTVR
A2074 Pafah1b1Platelet-activating factor acetylhydrolase IB subunit alphaGHTDSVQDISFDHSGK
A207D Crip2Cysteine-rich protein 2ASSVTTFTGEPNMcPR
A207D Crip2Cysteine-rich protein 2TVYFAEK
A207F Abhd2Abhydrolase domain-containing protein 2SPHPYGHR
A207F Abhd2Abhydrolase domain-containing protein 2MNAmLETPELPAVFDGVK
A2091 Nle1Notchless protein homolog 1mAAAVVEEAAAGDVQR
A209E Qil1Protein QIL1EGWEYLK
A2102 CopaCoatomer subunit alphaVKGNnVYcLDR
A2102 CopaCoatomer subunit alphaGITGVDLFGTTDAVVK
A2102 CopaCoatomer subunit alphaAWEVDTcR
A2102 CopaCoatomer subunit alphaASNLENSTYDLYTIPK
A2102 CopaCoatomer subunit alphaNLSPGAVESDVR
A2102 CopaCoatomer subunit alphaDVAVMQLR
A2102 CopaCoatomer subunit alphaLLELGPKPEVAQQTR
A2102 CopaCoatomer subunit alphaVLTIDPTEFK
A2102 CopaCoatomer subunit alphaQELILSNSEDK
A2102 CopaCoatomer subunit alphaVKGNnVYcLDR
A2102 CopaCoatomer subunit alphaGITGVDLFGTTDAVVK
A2102 CopaCoatomer subunit alphaAWEVDTcR
A2102 CopaCoatomer subunit alphaASNLENSTYDLYTIPK
A2102 CopaCoatomer subunit alphaNLSPGAVESDVR
A2102 CopaCoatomer subunit alphaLLELGPKPEVAQQTR
A2102 CopaCoatomer subunit alphaVLTIDPTEFK
A2102 CopaCoatomer subunit alphaQELILSNSEDK
A2109 Rfwd2E3 ubiquitin-protein ligase RFWD2nTKqPImVFK
A2109 Rfwd2E3 ubiquitin-protein ligase RFWD2cIHqSLEDNNRcPK
A2109 Rfwd2E3 ubiquitin-protein ligase RFWD2REqLEQIqK
A2114 Sec31aProtein transport protein Sec31AFASSPLR
A2114 Sec31aProtein transport protein Sec31ANPAVLSAASFDGR
A2114 Sec31aProtein transport protein Sec31ALVTFESVAVPLQQGAEQQR
A2114 Sec31aProtein transport protein Sec31AAQGKPVSGQESSQSPYER
A2114 Sec31aProtein transport protein Sec31ATTFEDLIQR
A2114 Sec31aProtein transport protein Sec31AKNEPIIK
A2114 Sec31aProtein transport protein Sec31AcLSSATDPQTK
A2114 Sec31aProtein transport protein Sec31AAqDGSSPLSLQDLIEK
A211G Dyx1c1Dyslexia susceptibility 1 candidate gene 1 protein homologEKPLEGKqAEETK
A211G Dyx1c1Dyslexia susceptibility 1 candidate gene 1 protein homologAKEATEAK
A211G Dyx1c1Dyslexia susceptibility 1 candidate gene 1 protein homologEKPLEGKqAEETK
A211G Dyx1c1Dyslexia susceptibility 1 candidate gene 1 protein homologAKEATEAK
A2134 Pwp2Periodic tryptophan protein 2 homologETTIRGK
A2134 Pwp2Periodic tryptophan protein 2 homologFnIqYVLAVSK
A213A AireAutoimmune regulatorFEDPSGNLKnK
A213A AireAutoimmune regulatorFEDPSGNLKnK
A213F Acap1Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1QKELGGEEPEPSLK
A213F Acap1Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1QKELGGEEPEPSLK
A213H Lsm5U6 snRNA-associated Sm-like protein LSm5mAANATTNPSqLLPLELVDKcIGSR
A213H Lsm5U6 snRNA-associated Sm-like protein LSm5IHIVMKSDK
A2141 Coro1bCoronin-1BAIFLADGK
A2141 Coro1bCoronin-1BVTWDSTFcAVNPK
A2153 Skiv2l2Superkiller viralicidic activity 2-like 2EDNFnTAmqVLR
A2153 Skiv2l2Superkiller viralicidic activity 2-like 2DLRPVDnR
A2153 Skiv2l2Superkiller viralicidic activity 2-like 2GMDDRGIVILmVDEK
A2153 Skiv2l2Superkiller viralicidic activity 2-like 2TVLFTNAR
A2153 Skiv2l2Superkiller viralicidic activity 2-like 2AIGNTELENKFAEGITK
A2153 Skiv2l2Superkiller viralicidic activity 2-like 2EDNFnTAmqVLR
A2153 Skiv2l2Superkiller viralicidic activity 2-like 2AqVALDIKSAK
A2153 Skiv2l2Superkiller viralicidic activity 2-like 2DLRPVDnR
A2153 Skiv2l2Superkiller viralicidic activity 2-like 2GMDDRGIVILmVDEK
A2153 Skiv2l2Superkiller viralicidic activity 2-like 2TVLFTNAR
A2153 Skiv2l2Superkiller viralicidic activity 2-like 2AIGNTELENKFAEGITK
A215B Zcwpw1Zinc finger CW-type PWWP domain protein 1MMAALQTHKEYEK
A216J Slc7a6Y+L amino acid transporter 2EDAGSPSqGSPETMqLK
A2170 Baz2aBromodomain adjacent to zinc finger domain protein 2AVVLSDLqIR
A2170 Baz2aBromodomain adjacent to zinc finger domain protein 2AAALHDPGLPPYcQSLK
A2170 Baz2aBromodomain adjacent to zinc finger domain protein 2AMPELLNK
A2172 Trim33E3 ubiquitin-protein ligase TRIM33TPGqInLAqLR
A2172 Trim33E3 ubiquitin-protein ligase TRIM33VEqEIKVAIFTLInEINK
A2172 Trim33E3 ubiquitin-protein ligase TRIM33TPGqInLAqLR
A2172 Trim33E3 ubiquitin-protein ligase TRIM33VEqEIKVAIFTLInEINK
A218I Rtel1Regulator of telomere elongation helicase 1DVAqFFRVAqK
A218I Rtel1Regulator of telomere elongation helicase 1VQGELFASR
A218I Rtel1Regulator of telomere elongation helicase 1LVNHPEEPmAGTQAGR
A218I Rtel1Regulator of telomere elongation helicase 1MQFLDEmR
A218I Rtel1Regulator of telomere elongation helicase 1GFGMFVRR
A218I Rtel1Regulator of telomere elongation helicase 1VQGELFASR
A2191 Sox7Transcription factor SOX-7RLAVqNPDLHnAELSK
A2210 Sox6Transcription factor SOX-6FEnLGPQLTGK
A2210 Sox6Transcription factor SOX-6WKSmSNqEK
A2210 Sox6Transcription factor SOX-6GTSPVTqVK
A2223 Brd3Bromodomain-containing protein 3LQDVSGQLnSK
A2226 BptfBromodomain PHD finger transcription factor (Nucleosome-remodeling factor subunit BPTF)LTEFVADmTKIFDncR
A2226 BptfBromodomain PHD finger transcription factor (Nucleosome-remodeling factor subunit BPTF)HqVTGYGGWSWISK
A2226 BptfBromodomain PHD finger transcription factor (Nucleosome-remodeling factor subunit BPTF)AVQMcSKPR
A2226 BptfBromodomain PHD finger transcription factor (Nucleosome-remodeling factor subunit BPTF)KMISTTSK
A2226 BptfBromodomain PHD finger transcription factor (Nucleosome-remodeling factor subunit BPTF)ELqIQVqEELK
A2226 BptfBromodomain PHD finger transcription factor (Nucleosome-remodeling factor subunit BPTF)ESLGHTRLHR
A2226 BptfBromodomain PHD finger transcription factor (Nucleosome-remodeling factor subunit BPTF)QGQSNSGmVqVQqK
A2229 Phf8Histone lysine demethylase PHF8DVEHYVGSDKEIDVIDVAR
A2229 Phf8Histone lysine demethylase PHF8LAQQELQK
A222C Necap2Adaptin ear-binding coat-associated protein 2InIAnMRK
A222C Necap2Adaptin ear-binding coat-associated protein 2GDAFDFNVALQDHFKWVK
A222C Necap2Adaptin ear-binding coat-associated protein 2ATnRGYR
A222C Necap2Adaptin ear-binding coat-associated protein 2GDAFDFNVALQDHFKWVK
A222J Ythdf1YTH domain family protein 1mSATSVDPqRTK
A223A Actr5Actin-related protein 5qASRASETqTSGR
A223F Chrnb1Acetylcholine receptor subunit betaqLQEqEDHDALK
A223F Chrnb1Acetylcholine receptor subunit betaLIQLPGDqR
A2247 Fbxo18F-box only protein 18LNGVLEASR
A2247 Fbxo18F-box only protein 18LNGVLEASR
A224I Rundc3bRUN domain-containing protein 3BmASRSLGGLSGSR
A2261 Angptl6Angiopoietin-related protein 6VTLVLSPQKATSAVcR
A2272 Angptl4Angiopoietin-related protein 4IqQLFqKVAqqQR
A2272 Angptl4Angiopoietin-related protein 4MTQLIGLTPnATHLHRPPR
A227F Actl7aActin-like protein 7AHFSEDHLGIVEDIKTR
A227F Actl7aActin-like protein 7AYAEmLFETFnTPAMHIAYqSR
A2286 Kctd12BTB/POZ domain-containing protein KCTD12MFTQQQPQELAR
A2286 Kctd12BTB/POZ domain-containing protein KCTD12MFTQQQPQELAR
A230A Asxl2Putative Polycomb group protein ASXL2mPPATVTDqIqESLK
A230A Asxl2Putative Polycomb group protein ASXL2mPPATVTDqIqESLK
A2318 MicalclMICAL C-terminal-like proteinEEQEIFEEMMqVIEqRNK
A2319 Mical1Protein-methionine sulfoxide oxidase MICAL1ESLYqLLSqTSPEnmHR
A2319 Mical1Protein-methionine sulfoxide oxidase MICAL1DALIqFqEERR
A2319 Mical1Protein-methionine sulfoxide oxidase MICAL1ESLYqLLSqTSPEnmHR
A231A Asxl3Putative Polycomb group protein ASXL3EQETTIETSAmALR
A231A Asxl3Putative Polycomb group protein ASXL3nTAPPVVSHSSSSK
A231A Asxl3Putative Polycomb group protein ASXL3AQQARAQR
A2324 Ehbp1EH domain-binding protein 1NPVVFnK
A2324 Ehbp1EH domain-binding protein 1VLLEqAR
A2324 Ehbp1EH domain-binding protein 1mNqLSLLEK
A2325 Specc1Cytospin-BLLNIqqQLTcSLRK
A2325 Specc1Cytospin-BDMKETIFELEDqVEqHR
A2325 Specc1Cytospin-BcEAQQELRTVK
A2325 Specc1Cytospin-BSNTGTIPTTK
A2325 Specc1Cytospin-BVEEEnQGAIDMIK
A2325 Specc1Cytospin-BLLNIqqQLTcSLRK
A2325 Specc1Cytospin-BTAPAAAVSPMQR
A2325 Specc1Cytospin-BDMKETIFELEDqVEqHR
A2325 Specc1Cytospin-BcEAQQELRTVK
A2325 Specc1Cytospin-BVEEEnQGAIDMIK
A2325 Specc1Cytospin-BLLNIqqQLTcSLRK
A2325 Specc1Cytospin-BSPLSGIPVR
A2325 Specc1Cytospin-BTAPAAAVSPMQR
A2325 Specc1Cytospin-BDMKETIFELEDqVEqHR
A2325 Specc1Cytospin-BcEAQQELRTVK
A2325 Specc1Cytospin-BSNTGTIPTTK
A2328 Golga3Golgin subfamily A member 3GDTKLHnQNSVPR
A2328 Golga3Golgin subfamily A member 3EATDAELnQLR
A2328 Golga3Golgin subfamily A member 3QIEELQQEAKK
A2328 Golga3Golgin subfamily A member 3qmKqLVQALqVSLEK
A2328 Golga3Golgin subfamily A member 3RLEGqVEALSLEASQALqEK
A2328 Golga3Golgin subfamily A member 3AYENAVSILSR
A2328 Golga3Golgin subfamily A member 3nnMKTLLqQnQQLK
A2328 Golga3Golgin subfamily A member 3HFKAATLELSEVK
A2328 Golga3Golgin subfamily A member 3NNmKTLLQqNQQLK
A2328 Golga3Golgin subfamily A member 3DmSLVHQQMAELEGHLqSVQK
A2328 Golga3Golgin subfamily A member 3GDTKLHnQNSVPR
A2328 Golga3Golgin subfamily A member 3EATDAELnQLR
A2328 Golga3Golgin subfamily A member 3QIEELQQEAKK
A2328 Golga3Golgin subfamily A member 3qmKqLVQALqVSLEK
A2328 Golga3Golgin subfamily A member 3RLEGqVEALSLEASQALqEK
A2328 Golga3Golgin subfamily A member 3AYENAVSILSR
A2328 Golga3Golgin subfamily A member 3HFKAATLELSEVK
A2328 Golga3Golgin subfamily A member 3NNmKTLLQqNQQLK
A232C Npc1l1Niemann-Pick C1-like protein 1YLPWFLNDTPNIR
A232I Rxfp1Relaxin receptor 1LHWLDFEGnRIHnLR
A232I Rxfp1Relaxin receptor 1TLPPnGFRK
A232I Rxfp1Relaxin receptor 1IENLPPNIFKDLK
A2339 SmtnSmoothelinAmIEKLEK
A233A Atoh8Protein atonal homolog 8IAcnYILSLAR
A233C Slc17a1Sodium-dependent phosphate transport protein 1VcLnLTMVAMVnNTGSPHLSNESVVEmLDnVK
A2346 Clip2CAP-Gly domain-containing linker protein 2VEDLqFR
A2346 Clip2CAP-Gly domain-containing linker protein 2VEDLqFR
A234C Slc34a1Sodium-dependent phosphate transport protein 2ALIIQLDK
A234C Slc34a1Sodium-dependent phosphate transport protein 2AIWcHPDTTEASTSMSR
A234C Slc34a1Sodium-dependent phosphate transport protein 2AIPGTSTYAISSLSPVTLTEHScPcGEVLEcHDPLPTK
A234C Slc34a1Sodium-dependent phosphate transport protein 2ADAPDLLK
A234C Slc34a1Sodium-dependent phosphate transport protein 2ALAQEEEQKPEPR
A234C Slc34a1Sodium-dependent phosphate transport protein 2ALGGPAVSPLPVR
A234C Slc34a1Sodium-dependent phosphate transport protein 2ASVITSIAVGDESLR
A234C Slc34a1Sodium-dependent phosphate transport protein 2AMLnSLLK
A234C Slc34a1Sodium-dependent phosphate transport protein 2AVITEPFTR
A234C Slc34a1Sodium-dependent phosphate transport protein 2AIWcHPDTTEASTSMSR
A234C Slc34a1Sodium-dependent phosphate transport protein 2ALAQEEEQKPEPR
A234C Slc34a1Sodium-dependent phosphate transport protein 2ALGGPAVSPLPVR
A234C Slc34a1Sodium-dependent phosphate transport protein 2ASVITSIAVGDESLR
A234C Slc34a1Sodium-dependent phosphate transport protein 2AMLnSLLK
A2357 Arhgap31Rho GTPase-activating protein 31LSGITSnIqR
A2357 Arhgap31Rho GTPase-activating protein 31LcHRPSLRqSHSLDSK
A235C Slc34a2Sodium-dependent phosphate transport protein 2BLIIQLDK
A235C Slc34a2Sodium-dependent phosphate transport protein 2BcPRILPLK
A235C Slc34a2Sodium-dependent phosphate transport protein 2BASGAFDnAAMSKEcqDEGK
A235C Slc34a2Sodium-dependent phosphate transport protein 2BLIIQLDK
A235C Slc34a2Sodium-dependent phosphate transport protein 2BcPRILPLK
A235J Zbtb42Zinc finger and BTB domain-containing protein 42TFScTYTLKR
A235J Zbtb42Zinc finger and BTB domain-containing protein 42TFScTYTLKR
A2360 Arhgap1Rho GTPase-activating protein 1YDDFLK
A2360 Arhgap1Rho GTPase-activating protein 1YNMGLPVDFDQYNELHLPAVILK
A2360 Arhgap1Rho GTPase-activating protein 1qVLKYDDFLK
A2360 Arhgap1Rho GTPase-activating protein 1HQIVEVAGDDKYGR
A2360 Arhgap1Rho GTPase-activating protein 1ETVAYLQAHALTTEGIFR
A2360 Arhgap1Rho GTPase-activating protein 1FLLDHQGELFPSTDAQGV
A2360 Arhgap1Rho GTPase-activating protein 1LEQLGIPR
A2366 DLC1Rho GTPase-activating protein 7TLSTmqSSqDSHNTWRmAGK
A2366 DLC1Rho GTPase-activating protein 7DATLnGDHKEK
A2366 DLC1Rho GTPase-activating protein 7TLSTmqSSqDSHNTWRmAGK
A2366 DLC1Rho GTPase-activating protein 7TLSTmqSSqDSHNTWRmAGK
A2366 DLC1Rho GTPase-activating protein 7ELSSFSFSMK
A2366 DLC1Rho GTPase-activating protein 7QDPIPGSPDNSR
A236F Actrt3Actin-related protein T3GDGImLLR
A2373 Arhgap19Rho GTPase-activating protein 19KVLGSQmTSEK
A2374 AbrActive breakpoint cluster region-related proteinGqIqLDPqTVESK
A2374 AbrActive breakpoint cluster region-related proteinAFVDNYKVALETAEK
A2374 AbrActive breakpoint cluster region-related proteinAVFDAnnKDILLMLSDMDInAIAGTLK
A2374 AbrActive breakpoint cluster region-related proteinmFEnEFLLLLNSPTIPFR
A2374 AbrActive breakpoint cluster region-related proteinGqIqLDPqTVESK
A2374 AbrActive breakpoint cluster region-related proteinAFVDNYKVALETAEK
A2374 AbrActive breakpoint cluster region-related proteinmFEnEFLLLLNSPTIPFR
A2375 Chn2Beta-chimaerinFGNQTLnYR
A2377 Arhgap22Rho GTPase-activating protein 22ASSGDRLK
A2377 Arhgap22Rho GTPase-activating protein 22ASSGDRLK
A2381 Arhgef17Rho guanine nucleotide exchange factor 17LASGPPAAPAqPRPLR
A2381 Arhgef17Rho guanine nucleotide exchange factor 17EEGnQDqTGSLTqTRSSSK
A2381 Arhgef17Rho guanine nucleotide exchange factor 17QVAERInK
A2381 Arhgef17Rho guanine nucleotide exchange factor 17QPPTPPPRTcFPLAGLR
A2381 Arhgef17Rho guanine nucleotide exchange factor 17EEGnQDqTGSLTQTR
A2381 Arhgef17Rho guanine nucleotide exchange factor 17QVAERInK
A2385 Arhgap42Rho GTPase-activating protein 42SGGIPWITTPSSSNGQK
A2385 Arhgap42Rho GTPase-activating protein 42LRLDTASSnGYQRPGSVVAAK
A2385 Arhgap42Rho GTPase-activating protein 42LLIAVEEER
A2385 Arhgap42Rho GTPase-activating protein 42DGSLLIGALRnLSmAVqK
A238H Map3k14Mitogen-activated protein kinase kinase kinase 14AVGVPAqGLWSSWPRV
A2390 GmipGEM-interacting proteinMEIEKWR
A2390 GmipGEM-interacting proteinAWSRYAK
A2392 Hmha1Minor histocompatibility protein HA-1APLPTMRLR
A2392 Hmha1Minor histocompatibility protein HA-1ASYSPHQAEWPATRSGLNLGGR
A2392 Hmha1Minor histocompatibility protein HA-1LqEAEANLRK
A2392 Hmha1Minor histocompatibility protein HA-1GRqGGSESEAATLAMVGR
A2392 Hmha1Minor histocompatibility protein HA-1APLPTMRLR
A2392 Hmha1Minor histocompatibility protein HA-1GRqGGSESEAATLAMVGR
A2392 Hmha1Minor histocompatibility protein HA-1APLPTMRLR
A2392 Hmha1Minor histocompatibility protein HA-1LqEAEANLRK
A2392 Hmha1Minor histocompatibility protein HA-1APLPTMRLR
A2392 Hmha1Minor histocompatibility protein HA-1LqEAEANLRK
A2392 Hmha1Minor histocompatibility protein HA-1GRqGGSESEAATLAMVGR
A2398 Appl2DCC-interacting protein 13-betaVYGAQNEMcLATQqLSR
A2398 Appl2DCC-interacting protein 13-betaqLLAYEK
A2398 Appl2DCC-interacting protein 13-betaQLADTMVLPVIQFR
A2398 Appl2DCC-interacting protein 13-betaDPEALAR
A2398 Appl2DCC-interacting protein 13-betaKQESScSSqnIK
A2398 Appl2DCC-interacting protein 13-betaLNQTALQAVTPITSFGK
A2398 Appl2DCC-interacting protein 13-betaVYGAQNEMcLATQqLSR
A2398 Appl2DCC-interacting protein 13-betaqLLAYEK
A2398 Appl2DCC-interacting protein 13-betaQLADTMVLPVIQFR
A239D Cttnbp2nlCTTNBP2 N-terminal-like proteinLLGSAASSPGYQSSYqVGInqR
A2404 Xirp1Xin actin-binding repeat-containing protein 1mADAqMQVAPTPTIqMR
A2411 Smc2Structural maintenance of chromosomes protein 2EKqQEVEAITLELEELK
A2411 Smc2Structural maintenance of chromosomes protein 2YEALEnKmK
A2411 Smc2Structural maintenance of chromosomes protein 2ENLTELSGGQR
A2411 Smc2Structural maintenance of chromosomes protein 2ASNLQDLVYK
A2411 Smc2Structural maintenance of chromosomes protein 2NQALnIAWqKVnK
A2411 Smc2Structural maintenance of chromosomes protein 2EKqQEVEAITLELEELK
A2411 Smc2Structural maintenance of chromosomes protein 2NQALNIAWQK
A2411 Smc2Structural maintenance of chromosomes protein 2YNDLmKK
A2411 Smc2Structural maintenance of chromosomes protein 2nVAEKYR
A2411 Smc2Structural maintenance of chromosomes protein 2DnSTATALEVVAGER
A2411 Smc2Structural maintenance of chromosomes protein 2DVQDELR
A2411 Smc2Structural maintenance of chromosomes protein 2YEALEnKmK
A2411 Smc2Structural maintenance of chromosomes protein 2ENLTELSGGQR
A2411 Smc2Structural maintenance of chromosomes protein 2ASNLQDLVYK
A2411 Smc2Structural maintenance of chromosomes protein 2NQALnIAWqKVnK
A241A Bcorl1BCL-6 corepressor-like protein 1LASSDNmKR
A241A Bcorl1BCL-6 corepressor-like protein 1KPTKPESqPPGKR
A241A Bcorl1BCL-6 corepressor-like protein 1GQAEARANAGQAR
A241A Bcorl1BCL-6 corepressor-like protein 1LASSDNmKR
A241A Bcorl1BCL-6 corepressor-like protein 1KPTKPESqPPGKR
A241A Bcorl1BCL-6 corepressor-like protein 1GQAEARANAGQAR
A241A Bcorl1BCL-6 corepressor-like protein 1GQAEARANAGQAR
A2426 Arfgef2ADP-ribosylation factor guanine nucleotide-exchange factor 2 (Brefeldin A-inhibited)LVnDLSKIAqGR
A2426 Arfgef2ADP-ribosylation factor guanine nucleotide-exchange factor 2 (Brefeldin A-inhibited)LLYnVEMEQMAK
A2428 Iqsec1IQ motif and SEC7 domain-containing protein 1IGLnLFnK
A2428 Iqsec1IQ motif and SEC7 domain-containing protein 1GLSRQMIGEFLGnR
A2428 Iqsec1IQ motif and SEC7 domain-containing protein 1QmIGEFLGNRQK
A2428 Iqsec1IQ motif and SEC7 domain-containing protein 1IGLnLFnK
A2428 Iqsec1IQ motif and SEC7 domain-containing protein 1GLSRQMIGEFLGnR
A2428 Iqsec1IQ motif and SEC7 domain-containing protein 1QmIGEFLGNRQK
A2429 Iqsec2IQ motif and SEC7 domain-containing protein 2IGLnLFnK
A2429 Iqsec2IQ motif and SEC7 domain-containing protein 2MNKnFER
A2429 Iqsec2IQ motif and SEC7 domain-containing protein 2GLSRQMIGEFLGnR
A2429 Iqsec2IQ motif and SEC7 domain-containing protein 2qKGMMRPnASqPGGAK
A2429 Iqsec2IQ motif and SEC7 domain-containing protein 2IEELEGqLDqLTQENR
A2429 Iqsec2IQ motif and SEC7 domain-containing protein 2IGLnLFnK
A2429 Iqsec2IQ motif and SEC7 domain-containing protein 2MNKnFER
A2429 Iqsec2IQ motif and SEC7 domain-containing protein 2GLSRQMIGEFLGnR
A2429 Iqsec2IQ motif and SEC7 domain-containing protein 2qKGMMRPnASqPGGAK
A2429 Iqsec2IQ motif and SEC7 domain-containing protein 2QmIGEFLGNRQK
A2429 Iqsec2IQ motif and SEC7 domain-containing protein 2IGLnLFnK
A2429 Iqsec2IQ motif and SEC7 domain-containing protein 2MNKnFER
A2429 Iqsec2IQ motif and SEC7 domain-containing protein 2GLSRQMIGEFLGnR
A2429 Iqsec2IQ motif and SEC7 domain-containing protein 2qKGMMRPnASqPGGAK
A2429 Iqsec2IQ motif and SEC7 domain-containing protein 2QmIGEFLGNRQK
A2429 Iqsec2IQ motif and SEC7 domain-containing protein 2IEELEGqLDqLTQENR
A242H Map4k3Mitogen-activated protein kinase kinase kinase kinase 3RNPqEDFELIqR
A242H Map4k3Mitogen-activated protein kinase kinase kinase kinase 3mnPGFDLSRR
A242J Zc3h12cProbable ribonuclease ZC3H12CLNSQPFLQnFHDPLTR
A242J Zc3h12cProbable ribonuclease ZC3H12CLNSQPFLQnFHDPLTR
A2431 PsdPH and SEC7 domain-containing protein 1ALYSSIKnEK
A2431 PsdPH and SEC7 domain-containing protein 1HLGKnNDFSK
A2431 PsdPH and SEC7 domain-containing protein 1LSQEEQVR
A2436 Arfgef3Brefeldin A-inhibited guanine nucleotide-exchange protein 3VTPSLNEDLQVEVmK
A2456 Ehmt1Histone-lysine N-methyltransferase EHMT1ADTTSTVTLAPGqEK
A2456 Ehmt1Histone-lysine N-methyltransferase EHMT1VVqnGLRAR
A2456 Ehmt1Histone-lysine N-methyltransferase EHMT1VVqNGLR
A2459 Whsc1l1Histone-lysine N-methyltransferase NSD3RFqELK
A2459 Whsc1l1Histone-lysine N-methyltransferase NSD3qASNHSEKQK
A245C Nup155Nuclear pore complex protein Nup155ISLqAIqqLVR
A245C Nup155Nuclear pore complex protein Nup155YGGEAQMR
A245F Aadacl3Arylacetamide deacetylase-like 3KPSSIPR
A245I S100pbpS100P-binding proteinIDSSKETEnPASLR
A245I S100pbpS100P-binding proteinKPTPVFSqISNHSEVPnRK
A245J Zcchc18Zinc finger CCHC domain-containing protein 18RSETVmER
A248A Bnc1Zinc finger protein basonuclin-1SIVELMAIqEK
A248G Elmod1ELMO domain-containing protein 1TDFRGMGLLGLYnLQYFAER
A2492 Lmnb2Lamin-B2EGELTVAQGR
A2492 Lmnb2Lamin-B2VELEQTYQAK
A2492 Lmnb2Lamin-B2QVLEGEDIAYK
A250F Adnp2ADNP homeobox protein 2TEGSGPSEDSLQALALDPSK
A250F Adnp2ADNP homeobox protein 2GLGAVPLKR
A2515 Tial1Nucleolysin TIARFEDVVNQSSPK
A2515 Tial1Nucleolysin TIAREVKVNWATTPSSqK
A2524 Pabpc1lEmbryonic poly(A)-binding proteinALDTmNFEVIKGqPIR
A2524 Pabpc1lEmbryonic poly(A)-binding proteinGFGFVcFSSPEEATK
A2524 Pabpc1lEmbryonic poly(A)-binding proteinAINTmNGMLLnDR
A2530 Celf1CUGBP Elav-like family member 1DLRELFEqYGAVYEInILR
A2538 Rbm28RNA-binding protein 28nLYLAREGLIR
A2538 Rbm28RNA-binding protein 28TVAVDWAVAK
A2546 Dazap1DAZ-associated protein 1NQAPGQPGASQWGSR
A2548 Hnrnpa0Heterogeneous nuclear ribonucleoprotein A0AEIIADKqSGK
A2550 SRSF5Serine/arginine-rich-splicing factor 5mSGcRVFIGR
A2550 SRSF5Serine/arginine-rich-splicing factor 5LIVENLSSR
A2550 SRSF5Serine/arginine-rich-splicing factor 5mSGcRVFIGR
A2550 SRSF5Serine/arginine-rich-splicing factor 5LIVENLSSR
A2550 SRSF5Serine/arginine-rich-splicing factor 5mSGcRVFIGR
A2551 Srsf4Serine/arginine-rich splicing factor 4IRLVEDKPGSR
A2551 Srsf4Serine/arginine-rich splicing factor 4LIVENLSSR
A2551 Srsf4Serine/arginine-rich splicing factor 4SPSRSASR
A2555 RbmxRNA-binding motif protein, X chromosomeREPLPSR
A2555 RbmxRNA-binding motif protein, X chromosomeDMnGKSLDGK
A2555 RbmxRNA-binding motif protein, X chromosomeVEQATKPSFESGR
A2555 RbmxRNA-binding motif protein, X chromosomeDRDYSDHPSGGSYR
A2555 RbmxRNA-binding motif protein, X chromosomeDVYLSPR
A2555 RbmxRNA-binding motif protein, X chromosomeLFIGGLNTETNEK
A2555 RbmxRNA-binding motif protein, X chromosomeGFAFVTFESPADAK
A2556 Rbmxl1RNA binding motif protein, X-linked-like-1REPLPSR
A2556 Rbmxl1RNA binding motif protein, X-linked-like-1DMnGKSLDGK
A2556 Rbmxl1RNA binding motif protein, X-linked-like-1DSYESYGNSR
A2556 Rbmxl1RNA binding motif protein, X-linked-like-1DRDYSDHPSGGSYR
A2556 Rbmxl1RNA binding motif protein, X-linked-like-1GLPPSmER
A2556 Rbmxl1RNA binding motif protein, X-linked-like-1DVYLSPR
A2556 Rbmxl1RNA binding motif protein, X-linked-like-1LFIGGLNTETNEK
A2556 Rbmxl1RNA binding motif protein, X-linked-like-1RSTPSGPVR
A2556 Rbmxl1RNA binding motif protein, X-linked-like-1REPLPSR
A2556 Rbmxl1RNA binding motif protein, X-linked-like-1DMnGKSLDGK
A2556 Rbmxl1RNA binding motif protein, X-linked-like-1VEQATKPSFESGR
A2556 Rbmxl1RNA binding motif protein, X-linked-like-1DSYESYGNSR
A2556 Rbmxl1RNA binding motif protein, X-linked-like-1DRDYSDHPSGGSYR
A2556 Rbmxl1RNA binding motif protein, X-linked-like-1GLPPSmER
A2556 Rbmxl1RNA binding motif protein, X-linked-like-1DVYLSPR
A2556 Rbmxl1RNA binding motif protein, X-linked-like-1LFIGGLNTETNEK
A2556 Rbmxl1RNA binding motif protein, X-linked-like-1GFAFVTFESPADAK
A2556 Rbmxl1RNA binding motif protein, X-linked-like-1RSTPSGPVR
A2562 Rbm3Putative RNA-binding protein 3AMNGESLDGR
A256C Nup88Nuclear pore complex protein Nup88nIFEqKDR
A256C Nup88Nuclear pore complex protein Nup88ELQLIPDQLR
A256C Nup88Nuclear pore complex protein Nup88SSEKDLAPPPEEcLqLISR
A2573 Rbm39RNA-binding protein 39VLGVPIIVQASqAEK
A2573 Rbm39RNA-binding protein 39AAAmANNLQK
A2573 Rbm39RNA-binding protein 39VLGVPIIVQASqAEK
A2573 Rbm39RNA-binding protein 39AAAmANNLQK
A257E Rprd2Regulation of nuclear pre-mRNA domain-containing protein 2HFGQTPNK
A257E Rprd2Regulation of nuclear pre-mRNA domain-containing protein 2HFGQTPNK
A257E Rprd2Regulation of nuclear pre-mRNA domain-containing protein 2DLnGPGLNRSR
A2580 Srsf2Serine/arginine-rich splicing factor 2VGDVYIPR
A2580 Srsf2Serine/arginine-rich splicing factor 2VDNLTYR
A2580 Srsf2Serine/arginine-rich splicing factor 2VGDVYIPR
A2580 Srsf2Serine/arginine-rich splicing factor 2VDNLTYR
A2580 Srsf2Serine/arginine-rich splicing factor 2RSPALGDAGAAISKPESVqVAK
A2580 Srsf2Serine/arginine-rich splicing factor 2VGDVYIPR
A2580 Srsf2Serine/arginine-rich splicing factor 2SPDPARGQGPGR
A2580 Srsf2Serine/arginine-rich splicing factor 2VDNLTYR
A2585 PpiePeptidyl-prolyl cis-trans isomerase ETDWLDGK
A2591 SsbLupus La protein homologARNANNGNLLLR
A2591 SsbLupus La protein homologGqILNIQMR
A2591 SsbLupus La protein homologITDDQQESLNK
A2591 SsbLupus La protein homologNANNGNLLLR
A2591 SsbLupus La protein homologFSGDLDDQTcR
A2591 SsbLupus La protein homologARNANNGNLLLR
A2591 SsbLupus La protein homologGqILNIQMR
A2591 SsbLupus La protein homologITDDQQESLNK
A2591 SsbLupus La protein homologNANNGNLLLR
A2591 SsbLupus La protein homologFSGDLDDQTcR
A2591 SsbLupus La protein homologLMEVSADKTK
A2591 SsbLupus La protein homologGSHVFTAAR
A2597 Larp4bLa-related protein 4BLSKEQNTPPK
A2597 Larp4bLa-related protein 4BLInGVRSPqTR
A2597 Larp4bLa-related protein 4BLSKEQNTPPK
A2597 Larp4bLa-related protein 4BSTPGVPKDQR
A2597 Larp4bLa-related protein 4BIqNPSAYAKR
A260G Emid1EMI domain-containing protein 1VSELTER
A2614 PapolgPoly(A) polymerase gammaVLVGNLER
A261A Btf3Transcription factor BTF3MKETIMNQEK
A261A Btf3Transcription factor BTF3MKETIMNQEK
A261D  Uncharacterized protein CXorf38 homologAFMPRGLADK
A261D  Uncharacterized protein CXorf38 homolognGLTEDLqKLESLHLqHqK
A2622 Ptprn2Receptor-type tyrosine-protein phosphatase N2TYSKDLFER
A2622 Ptprn2Receptor-type tyrosine-protein phosphatase N2SFYLKnLqTnETR
A2622 Ptprn2Receptor-type tyrosine-protein phosphatase N2LEDqFQNR
A2622 Ptprn2Receptor-type tyrosine-protein phosphatase N2ADSVAGAIqSDPAEGSQESHGR
A2623 PtprtReceptor-type tyrosine-protein phosphatase TnNKSnmVETLEqYK
A2623 PtprtReceptor-type tyrosine-protein phosphatase TTVVHcLNGGGR
A2623 PtprtReceptor-type tyrosine-protein phosphatase TnNKSnmVETLEqYK
A2623 PtprtReceptor-type tyrosine-protein phosphatase TTVVHcLNGGGR
A2624 PtprsReceptor-type tyrosine-protein phosphatase SFIREPK
A2624 PtprsReceptor-type tyrosine-protein phosphatase SEFKVTDAR
A2624 PtprsReceptor-type tyrosine-protein phosphatase SQLRSGALqIESSEETDQGK
A2624 PtprsReceptor-type tyrosine-protein phosphatase SLVnILPYESSRVcLqPIR
A2624 PtprsReceptor-type tyrosine-protein phosphatase SLVnILPYESSRVcLqPIR
A2629 Sdk1Protein sidekick-1LAGLPGEHqqR
A2629 Sdk1Protein sidekick-1HSFVNHYMSDPTYYNSWKR
A2629 Sdk1Protein sidekick-1VVTVDVK
A2629 Sdk1Protein sidekick-1HSFVNHYMSDPTYYNSWKR
A2629 Sdk1Protein sidekick-1VVTVDVK
A2633 Ctr9RNA polymerase-associated protein CTR9 homologLLKEqEEK
A2633 Ctr9RNA polymerase-associated protein CTR9 homologEVLnAVK
A2633 Ctr9RNA polymerase-associated protein CTR9 homologEVLnAVK
A2633 Ctr9RNA polymerase-associated protein CTR9 homologQYISAVQMVTSLLLRIVAcNVEPWLP
A264C OptnOptineurinANGHSSTEKqTAR
A264C OptnOptineurinEAMKLnnQAMK
A264I Slc35a1CMP-sialic acid transporterYTDnIMK
A265H Map9Microtubule-associated protein 9GEALQAFEK
A265H Map9Microtubule-associated protein 9MnDFHISDDEEK
A2677 Zfp60Zinc finger protein 60EKPYKcK
A2677 Zfp60Zinc finger protein 60EKPYKcK
A269C Osbpl5Oxysterol-binding protein-related protein 5mLQEAVLSIQEAQqELHRHLSTMLSSTVR
A269C Osbpl5Oxysterol-binding protein-related protein 5GILYGTMTMELGGK
A269C Osbpl5Oxysterol-binding protein-related protein 5MADSLKIR
A269C Osbpl5Oxysterol-binding protein-related protein 5mLQEAVLSIQEAQqELHRHLSTMLSSTVR
A269C Osbpl5Oxysterol-binding protein-related protein 5GILYGTMTMELGGK
A269C Osbpl5Oxysterol-binding protein-related protein 5RFSLcPPASTPqK
A269C Osbpl5Oxysterol-binding protein-related protein 5mLQEAVLSIQEAQqELHRHLSTMLSSTVR
A269C Osbpl5Oxysterol-binding protein-related protein 5GILYGTMTMELGGK
A269C Osbpl5Oxysterol-binding protein-related protein 5RFSLcPPASTPqK
A270H 39142E3 ubiquitin-protein ligase MARCH7EGRDESSR
A274G Epc2Enhancer of polycomb homolog 2LGLnGLAETTVAmEVT
A277C Pdcd6ipProgrammed cell death 6-interacting proteinqcqYKDTLPK
A277C Pdcd6ipProgrammed cell death 6-interacting proteinYYDQIcSIEPK
A277C Pdcd6ipProgrammed cell death 6-interacting proteinNIQVSHQEFSK
A277C Pdcd6ipProgrammed cell death 6-interacting proteinSTSVVEQGGIQTVDQLIK
A277C Pdcd6ipProgrammed cell death 6-interacting proteinLANQAADYFGDAFK
A277C Pdcd6ipProgrammed cell death 6-interacting proteinKDNDFIYHDR
A278A Ccar1Cell division cycle and apoptosis regulator protein 1AMKVnDLR
A278A Ccar1Cell division cycle and apoptosis regulator protein 1MAQFGGQK
A281K Zfp341Zinc finger protein 341NSVTVqVMALNPNR
A281K Zfp341Zinc finger protein 341SHMIqHKK
A281K Zfp341Zinc finger protein 341NSVTVqVmALnPnR
A281K Zfp341Zinc finger protein 341NSVTVqVMALNPNR
A281K Zfp341Zinc finger protein 341SHMIqHKK
A281K Zfp341Zinc finger protein 341DLQARRPPR
A281K Zfp341Zinc finger protein 341EHYLKLHAHIHSGEKPYK
A281K Zfp341Zinc finger protein 341NSVTVqVmALnPnR
A281K Zfp341Zinc finger protein 341HmqTHKVWPPGR
A2847 Znf354bZinc finger protein 354BmISVLqqGEEPWKSEK
A284A CebpzCCAAT/enhancer-binding protein zetaGKEnTDSVVmqPK
A285D DcakdDephospho-CoA kinase domain-containing proteinqAILLHAK
A285D DcakdDephospho-CoA kinase domain-containing proteinqAILLHAK
A285E Sbno1Protein strawberry notch homolog 1YGRnALEIVmK
A285E Sbno1Protein strawberry notch homolog 1ESSNKEVAR
A285E Sbno1Protein strawberry notch homolog 1YGRnALEIVmK
A285E Sbno1Protein strawberry notch homolog 1qRFmDGDK
A285E Sbno1Protein strawberry notch homolog 1AIQqFGRTHR
A285E Sbno1Protein strawberry notch homolog 1ESSNKEVAR
A286A CenpbMajor centromere autoantigen BKYGVASTcR
A287I Slc38a8Putative sodium-coupled neutral amino acid transporter 8SLYPQAAcR
A289C Plekhm1Pleckstrin homology domain-containing family M member 1EQLKLLGDYLGLcR
A289C Plekhm1Pleckstrin homology domain-containing family M member 1YQEqnVVS
A289C Plekhm1Pleckstrin homology domain-containing family M member 1LcEYYqPTALLR
A292H Nr3c2Mineralocorticoid receptorFYQLTK
A292H Nr3c2Mineralocorticoid receptorIYqnmEqLVK
A292H Nr3c2Mineralocorticoid receptorFYQLTK
A292H Nr3c2Mineralocorticoid receptorIYqnmEqLVK
A293E SelmSelenoprotein MVETcGGcqLNR
A293E SelmSelenoprotein MNYQELER
A294A CicProtein capicua homologDGRSPnK
A294A CicProtein capicua homologDGRSPnK
A294H Med12lMediator of RNA polymerase II transcription subunit 12-like proteinKPQVNAK
A296D Dip2bDisco-interacting protein 2 homolog BGInLScIRTcVVVAEERPR
A296D Dip2bDisco-interacting protein 2 homolog BGINLScIR
A296D Dip2bDisco-interacting protein 2 homolog BVSLqqSFSK
A296D Dip2bDisco-interacting protein 2 homolog BqKqPGVGPASVmVGnLVAGK
A296D Dip2bDisco-interacting protein 2 homolog BGInLScIRTcVVVAEERPR
A296D Dip2bDisco-interacting protein 2 homolog BGINLScIR
A296D Dip2bDisco-interacting protein 2 homolog BVSLqqSFSK
A296D Dip2bDisco-interacting protein 2 homolog BqKqPGVGPASVmVGnLVAGK
A297A CnbpCellular nucleic acid-binding proteincGETGHVAINcSK
A297A CnbpCellular nucleic acid-binding proteincYScGEFGHIQK
A300I Slc47a1Multidrug and toxin extrusion protein 1VNVALNSAVSHEPAHPVcPESHGEIMMTDLEK
A300I Slc47a1Multidrug and toxin extrusion protein 1VGNALGAGNIDQAK
A300I Slc47a1Multidrug and toxin extrusion protein 1AcQQAQVHANLK
A300I Slc47a1Multidrug and toxin extrusion protein 1TEESAPGPGGADAASER
A300I Slc47a1Multidrug and toxin extrusion protein 1KDETQLDQPMNQQQALPIRPK
A301D Ddx26bProtein DDX26BGAVELFLK
A301D Ddx26bProtein DDX26BKLSqqTK
A301D Ddx26bProtein DDX26BGAVELFLK
A301E Setd5SET domain-containing protein 5YLMEQNITK
A301E Setd5SET domain-containing protein 5VSAVSNSQHYPHR
A301E Setd5SET domain-containing protein 5WIKqALEEGMTqTSSVPqETR
A304I Slc6a18Sodium-dependent neutral amino acid transporter B(0)AT3VAQLPLK
A304I Slc6a18Sodium-dependent neutral amino acid transporter B(0)AT3VAQLPLK
A304I Slc6a18Sodium-dependent neutral amino acid transporter B(0)AT3TcHLEDFLDK
A304I Slc6a18Sodium-dependent neutral amino acid transporter B(0)AT3ATHLESGLK
A304I Slc6a18Sodium-dependent neutral amino acid transporter B(0)AT3VAQLPLK
A304I Slc6a18Sodium-dependent neutral amino acid transporter B(0)AT3ATHLESGLK
A3057 Zbed4Zinc finger BED domain-containing protein 4ITSLIAEmIALDLqPYSLVDnVGFNR
A3073 Gli2Zinc finger protein GLI2YTDPSSLR
A3074 Gli3Transcriptional activator GLI3YTDPSSLR
A3076 Glis1Zinc finger protein GLIS1mVAGRqAcR
A3076 Glis1Zinc finger protein GLIS1YTDPSSLR
A307A Cpsf1Cleavage and polyadenylation specificity factor subunit 1SSqPPADR
A307A Cpsf1Cleavage and polyadenylation specificity factor subunit 1RILqnAVR
A307A Cpsf1Cleavage and polyadenylation specificity factor subunit 1VLVDSSFGQPTTQGEVR
A307A Cpsf1Cleavage and polyadenylation specificity factor subunit 1nLMVYMYLPEAK
A307A Cpsf1Cleavage and polyadenylation specificity factor subunit 1DALLLSFK
A3084 Zbtb17Zinc finger and BTB domain-containing protein 17AAATMLSRLDQAR
A3084 Zbtb17Zinc finger and BTB domain-containing protein 17VLEqLnqqR
A3085 Gzf1GDNF-inducible zinc finger protein 1LGNGLSPETPSK
A3085 Gzf1GDNF-inducible zinc finger protein 1LGNGLSPETPSK
A308A Cpsf2Cleavage and polyadenylation specificity factor subunit 2IINQmKPR
A308A Cpsf2Cleavage and polyadenylation specificity factor subunit 2DEqLLTnVLETLRGDGNVLIAVDTAGR
A308C QkiProtein quakingSPTAQAAPR
A308F Ankrd6Ankyrin repeat domain-containing protein 6nQAGDTALHVAAALNHKK
A308F Ankrd6Ankyrin repeat domain-containing protein 6nQAGDTALHVAAALNHKK
A308I Inpp5fPhosphatidylinositide phosphatase SAC2FKDAYR
A308I Inpp5fPhosphatidylinositide phosphatase SAC2qTKSNVnIGNLR
A308I Inpp5fPhosphatidylinositide phosphatase SAC2TFTNIKSNVSAPNK
A308I Inpp5fPhosphatidylinositide phosphatase SAC2TnVVQAAIARVVmEqQLK
A308I Inpp5fPhosphatidylinositide phosphatase SAC2KLGnFTKPEMK
A3090 Prdm5PR domain zinc finger protein 5AFVTPSVLR
A3090 Prdm5PR domain zinc finger protein 5AFVTPSVLR
A309B ApmapAdipocyte plasma membrane-associated proteinLLLSSETPIEGK
A309B ApmapAdipocyte plasma membrane-associated proteinSLHDPDGQVVTYVSEAHEHDGYLYLGSFR
A309B ApmapAdipocyte plasma membrane-associated proteinIYFTDSSSK
A309B ApmapAdipocyte plasma membrane-associated proteinVYVSGLMK
A309B ApmapAdipocyte plasma membrane-associated proteinMIFKMFSqETVMK
A309B ApmapAdipocyte plasma membrane-associated proteinTRDDEPTcGRPLGIR
A309B ApmapAdipocyte plasma membrane-associated proteinLENGEIETIAR
A309B ApmapAdipocyte plasma membrane-associated proteinLLEYDTVTK
A309I Sac3d1SAC3 domain-containing protein 1SQARWImGGVSK
A311A Cpsf6Cleavage and polyadenylation specificity factor subunit 6QFLSQFEMQSR
A311A Cpsf6Cleavage and polyadenylation specificity factor subunit 6AnGQSKGFALVGVGSEASSK
A311A Cpsf6Cleavage and polyadenylation specificity factor subunit 6LmDLLPK
A312F Prmt2Protein arginine N-methyltransferase 2LHLEMLADqPRTTK
A312F Prmt2Protein arginine N-methyltransferase 2LHLEMLADqPRTTK
A312F Prmt2Protein arginine N-methyltransferase 2SGmEKAHVcLSELGcHVR
A313C Rab18Ras-related protein Rab-18IIQTPGLWESENQNK
A313C Rab18Ras-related protein Rab-18TLTPSYYR
A313C Rab18Ras-related protein Rab-18FRTLTPSYYR
A313E Sh3bgrlSH3 domain-binding glutamic acid-rich-like proteinVYIASSSGSTAIK
A315B BambiBMP and activin membrane-bound inhibitor homologmRQAELSNEK
A315F Ano10Anoctamin-10LEFESLEALKQQqMK
A315F Ano10Anoctamin-10KLEDTWYTR
A315G Fam118bProtein FAM118BFQKcLHEDK
A315G Fam118bProtein FAM118BFQKcLHEDK
A315G Fam118bProtein FAM118BFQKcLHEDK
A315G Fam118bProtein FAM118BFQKcLHEDK
A3167 L3mbtl1Lethal(3)malignant brain tumor-like protein 1DEmIDGEAFLLLTQADIVK
A3167 L3mbtl1Lethal(3)malignant brain tumor-like protein 1LLDWTGVSAPLPGSGmR
A3167 L3mbtl1Lethal(3)malignant brain tumor-like protein 1NPSnLSPR
A3167 L3mbtl1Lethal(3)malignant brain tumor-like protein 1FTAHHcLSGcPLAEK
A3167 L3mbtl1Lethal(3)malignant brain tumor-like protein 1LLDWTGVSAPLPGSGmR
A318A Cramp1lProtein cramped-likeLnELIQVGATTVRYK
A318A Cramp1lProtein cramped-likenNHAWARVQSLAQnPR
A318D Echdc3Enoyl-CoA hydratase domain-containing protein 3, mitochondrialQLPQDLR
A318D Echdc3Enoyl-CoA hydratase domain-containing protein 3, mitochondrialNALSLAMLK
A318D Echdc3Enoyl-CoA hydratase domain-containing protein 3, mitochondrialVVPEEQLEAETMR
A318D Echdc3Enoyl-CoA hydratase domain-containing protein 3, mitochondrialKVALEMLFTGEPISAQEALR
A318D Echdc3Enoyl-CoA hydratase domain-containing protein 3, mitochondrialNIVLSNPR
A3213 Smc3Structural maintenance of chromosomes protein 3ILmEFNK
A3213 Smc3Structural maintenance of chromosomes protein 3qLLnERIK
A3213 Smc3Structural maintenance of chromosomes protein 3KAEEELGELEAK
A3213 Smc3Structural maintenance of chromosomes protein 3INQMATAPDSQR
A3213 Smc3Structural maintenance of chromosomes protein 3YEAIqLTFKqVSK
A3213 Smc3Structural maintenance of chromosomes protein 3KDqYFLDK
A3213 Smc3Structural maintenance of chromosomes protein 3LVPGGKATLVMK
A3213 Smc3Structural maintenance of chromosomes protein 3ILmEFNK
A3213 Smc3Structural maintenance of chromosomes protein 3qLLnERIK
A3213 Smc3Structural maintenance of chromosomes protein 3KAEEELGELEAK
A3213 Smc3Structural maintenance of chromosomes protein 3INQMATAPDSQR
A3213 Smc3Structural maintenance of chromosomes protein 3YEAIqLTFKqVSK
A3213 Smc3Structural maintenance of chromosomes protein 3KDqYFLDK
A3213 Smc3Structural maintenance of chromosomes protein 3nIEnINNEIDQLMNQMQQIETQQR
A3213 Smc3Structural maintenance of chromosomes protein 3LVPGGKATLVMK
A321C Rab2bRas-related protein Rab-2BEHGLIFMETSAK
A321C Rab2bRas-related protein Rab-2BLQIWDTAGQESFR
A321C Rab2bRas-related protein Rab-2BEHGLIFMETSAK
A321C Rab2bRas-related protein Rab-2BETFNHLTSWLEDAR
A321C Rab2bRas-related protein Rab-2BFQPVHDLTIGVEFGAR
A321C Rab2bRas-related protein Rab-2BYIIIGDTGVGK
A321C Rab2bRas-related protein Rab-2BFQPVHDLTIGVEFGAR
A321C Rab2bRas-related protein Rab-2BYIIIGDTGVGK
A322B Btbd11Ankyrin repeat and BTB/POZ domain-containing protein BTBD11VYRWMVDSR
A322B Btbd11Ankyrin repeat and BTB/POZ domain-containing protein BTBD11VYRWMVDSR
A3236 Gfi1Zinc finger protein Gfi-1LLLGGGSYK
A3247 Ikzf2Zinc finger protein HelioscDVcGMVcIGPNVLMVHK
A3248 Ikzf4Zinc finger protein EoscDVcGMVcIGPNVLMVHK
A3248 Ikzf4Zinc finger protein EoscDVcGMVcIGPNVLMVHK
A325G Fam135bProtein FAM135BEKnLInQnSSSR
A325G Fam135bProtein FAM135BNLINqnSSSR
A325G Fam135bProtein FAM135BLDFLmSEK
A3265 Prdm1PR domain zinc finger protein 1LDSnPSKR
A3265 Prdm1PR domain zinc finger protein 1mLDLLLEK
A3265 Prdm1PR domain zinc finger protein 1InEEIERFDISDnADR
A3265 Prdm1PR domain zinc finger protein 1TFGQLSnLK
A3265 Prdm1PR domain zinc finger protein 1YVNPAHSAR
A3265 Prdm1PR domain zinc finger protein 1LDSnPSKR
A3265 Prdm1PR domain zinc finger protein 1InEEIERFDISDnADR
A3265 Prdm1PR domain zinc finger protein 1TFGQLSnLK
A3265 Prdm1PR domain zinc finger protein 1YVNPAHSAR
A3265 Prdm1PR domain zinc finger protein 1LDSnPSKR
A3265 Prdm1PR domain zinc finger protein 1InEEIERFDISDnADR
A3265 Prdm1PR domain zinc finger protein 1YVNPAHSAR
A326E Smcr8Smith-Magenis syndrome chromosomal region candidate gene 8 protein homologmEqELGDEEYTGVEATEAR
A326E Smcr8Smith-Magenis syndrome chromosomal region candidate gene 8 protein homologAnELANVEK
A326E Smcr8Smith-Magenis syndrome chromosomal region candidate gene 8 protein homologmEqELGDEEYTGVEATEAR
A326E Smcr8Smith-Magenis syndrome chromosomal region candidate gene 8 protein homologAnELANVEK
A327B C2cd2lC2 domain-containing protein 2-likeASISHVTcVDQSER
A327B C2cd2lC2 domain-containing protein 2-likeDAIVSTQPAmmVNLR
A328A Cux2Homeobox protein cut-like 2SLELqEPEGPLQR
A328E Smchd1Structural maintenance of chromosomes flexible hinge domain-containing protein 1ILnGqEQRmK
A328E Smchd1Structural maintenance of chromosomes flexible hinge domain-containing protein 1VQLVSGPPTK
A328E Smchd1Structural maintenance of chromosomes flexible hinge domain-containing protein 1GLVPIEcFNRISGALFTnDK
A328E Smchd1Structural maintenance of chromosomes flexible hinge domain-containing protein 1AGQLVKTIK
A328E Smchd1Structural maintenance of chromosomes flexible hinge domain-containing protein 1ILnGQEQR
A328E Smchd1Structural maintenance of chromosomes flexible hinge domain-containing protein 1KGEAMQK
A328G Fam154bProtein FAM154BqSNFPFQGK
A328G Fam154bProtein FAM154BIDLGTTYKR
A328G Fam154bProtein FAM154BVRPVERqqVK
A328G Fam154bProtein FAM154BDLnPYKVQPLIK
A3318 Zfy2Zinc finger Y-chromosomal protein 2SADSSnLK
A3318 Zfy2Zinc finger Y-chromosomal protein 2EFqqQcELQTHMK
A3319 Zfy1Zinc finger Y-chromosomal protein 1SADSSnLK
A3319 Zfy1Zinc finger Y-chromosomal protein 1EFqqQcELQTHMK
A331F Ankrd55Ankyrin repeat domain-containing protein 55DLPFTRnSLAPLPDQK
A331F Ankrd55Ankyrin repeat domain-containing protein 55MRQATMDFSTSSVFDqHK
A331F Ankrd55Ankyrin repeat domain-containing protein 55TALHWAVqSGnR
A331F Ankrd55Ankyrin repeat domain-containing protein 55DLPFTRnSLAPLPDQK
A331F Ankrd55Ankyrin repeat domain-containing protein 55TALHWAVqSGnR
A332B Minos1Mitochondrial inner membrane organizing system protein 1cMADTVVK
A332C Rab7aRas-related protein Rab-7aEAINVEQAFQTIAR
A332C Rab7aRas-related protein Rab-7aDPENFPFVVLGNK
A332C Rab7aRas-related protein Rab-7aATIGADFLTK
A332C Rab7aRas-related protein Rab-7aGADccVLVFDVTAPNTFK
A332C Rab7aRas-related protein Rab-7aIDLENR
A332C Rab7aRas-related protein Rab-7aAQAWcYSK
A332C Rab7aRas-related protein Rab-7aNNIPYFETSAK
A332C Rab7aRas-related protein Rab-7aVIILGDSGVGK
A332C Rab7aRas-related protein Rab-7aTLDSWRDEFLIQASPR
A332C Rab7aRas-related protein Rab-7aLVTMQIWDTAGQER
A332C Rab7aRas-related protein Rab-7aTSLMnqYVnKK
A332C Rab7aRas-related protein Rab-7aNALKQETEVELYnEFPEPIK
A333D Epg5Ectopic P granules protein 5 homologLmEAFFK
A333D Epg5Ectopic P granules protein 5 homologHVDIVPK
A333D Epg5Ectopic P granules protein 5 homologVDPGDnVIAK
A333D Epg5Ectopic P granules protein 5 homologAVVHALDK
A333D Epg5Ectopic P granules protein 5 homologDWLLNNnLTAVKNK
A335A Dcaf13DDB1- and CUL4-associated factor 13NIVLYDMRqATPLK
A335A Dcaf13DDB1- and CUL4-associated factor 13ETKLDIQR
A335A Dcaf13DDB1- and CUL4-associated factor 13AANDYNqKLK
A336A Ddb1DNA damage-binding protein 1QSGESIDIITR
A336A Ddb1DNA damage-binding protein 1QGQGQLVTcSGAFK
A336A Ddb1DNA damage-binding protein 1SDPGRETDDTLVLSFVGQTR
A336A Ddb1DNA damage-binding protein 1VVEELTR
A336A Ddb1DNA damage-binding protein 1QSGESIDIITR
A336A Ddb1DNA damage-binding protein 1QGQGQLVTcSGAFK
A337H Mfap3Microfibril-associated glycoprotein 3YIEELAR
A3388 Meox2Homeobox protein MOX-2SEVNSKPR
A338A DeddDeath effector domain-containing proteinnGRDFLLALER
A338A DeddDeath effector domain-containing proteinnGRDFLLALER
A338A DeddDeath effector domain-containing proteinnGRDFLLALER
A338G Fam169bProtein FAM169BILGLVNPqDTK
A338G Fam169bProtein FAM169BILGLVnPqDTK
A3394 En2Homeobox protein engrailed-2qSLAqELSLNESqIK
A340D Etaa1Ewing's tumor-associated antigen 1 homologAIcTSVGEnDTITSR
A3431 Shox2Short stature homeobox protein 2TnFTLEqLNELERLFDETHYPDAFMR
A3431 Shox2Short stature homeobox protein 2TnFTLEqLNELERLFDETHYPDAFMR
A344F Appbp2Amyloid protein-binding protein 2FDnALFHAER
A345B Ccdc90bCoiled-coil domain-containing protein 90B, mitochondrialLDINLERSR
A345B Ccdc90bCoiled-coil domain-containing protein 90B, mitochondrialFLRPDGGGIR
A345F Anapc1Anaphase-promoting complex subunit 1LLVPVDVDTNTPcYALIEVTYK
A345F Anapc1Anaphase-promoting complex subunit 1nVESHLLnK
A345F Anapc1Anaphase-promoting complex subunit 1GPRYWELLIDLSK
A345F Anapc1Anaphase-promoting complex subunit 1FAGSENLSAFScLHK
A345I Mau2MAU2 chromatid cohesion factor homologALMqLEK
A345I Mau2MAU2 chromatid cohesion factor homologALMqLEK
A3464 Pgrmc1Membrane-associated progesterone receptor component 1RFDGVQDPR
A3464 Pgrmc1Membrane-associated progesterone receptor component 1FDGVQDPR
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2IGIFGQDEDVTSK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2DIVPGDIVEIAVGDKVPADIR
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2NYLEQPGKEcVQPATK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2SMSVYcTPNKPSR
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2EEMHLEDSANFIK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2IVEFLQSFDEITAMTGDGVNDAPALKK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2VGEATETALTcLVEK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2GTAVAIcR
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2NYLEQPGK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2GAPEGVIDR
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2NAENAIEALKEYEPEMGK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2IEVASSVK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2EFTLEFSR
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2VIMITGDNK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2TGTLTTNQMSVcR
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2MNVFDTELK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2EWGSGSDTLR
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2HTDPVPDPR
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2SLPSVETLGcTSVIcSDK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2VPMTPGVK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2IRDEMVATEQER
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2ISLPVILMDETLK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2IERAnAcNSVIK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2VDQSILTGESVSVIK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2IEVASSVKLcR
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2FVARNYLEqPGK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2IGIFGQDEDVTSK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2DIVPGDIVEIAVGDKVPADIR
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2SMSVYcTPNKPSR
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2EEMHLEDSANFIK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2IVEFLQSFDEITAMTGDGVNDAPALKK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2VGEATETALTcLVEK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2GTAVAIcR
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2NAENAIEALKEYEPEMGK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2EFTLEFSR
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2VIMITGDNK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2TGTLTTNQMSVcR
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2MNVFDTELK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2EWGSGSDTLR
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2HTDPVPDPR
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2SLPSVETLGcTSVIcSDK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2ISLPVILMDETLK
A3467 Atp2a2Sarcoplasmic/endoplasmic reticulum calcium ATPase 2VDQSILTGESVSVIK
A3468 Atp2a1Sarcoplasmic/endoplasmic reticulum calcium ATPase 1AnAcNSVIR
A3468 Atp2a1Sarcoplasmic/endoplasmic reticulum calcium ATPase 1DQMAATEQDKTPLQqK
A3468 Atp2a1Sarcoplasmic/endoplasmic reticulum calcium ATPase 1MnVFNTEVRSLSK
A3468 Atp2a1Sarcoplasmic/endoplasmic reticulum calcium ATPase 1GAPEGVIDR
A3468 Atp2a1Sarcoplasmic/endoplasmic reticulum calcium ATPase 1NAENAIEALKEYEPEMGK
A3468 Atp2a1Sarcoplasmic/endoplasmic reticulum calcium ATPase 1EFTLEFSR
A3468 Atp2a1Sarcoplasmic/endoplasmic reticulum calcium ATPase 1VIMITGDNK
A3468 Atp2a1Sarcoplasmic/endoplasmic reticulum calcium ATPase 1HTDPVPDPR
A3468 Atp2a1Sarcoplasmic/endoplasmic reticulum calcium ATPase 1SLPSVETLGcTSVIcSDK
A3468 Atp2a1Sarcoplasmic/endoplasmic reticulum calcium ATPase 1EFDDLPLAEQR
A3468 Atp2a1Sarcoplasmic/endoplasmic reticulum calcium ATPase 1VDQSILTGESVSVIK
A3468 Atp2a1Sarcoplasmic/endoplasmic reticulum calcium ATPase 1nMLFSGTNIAAGKAVGIVATTGVSTEIGK
A346A Dmrt1Doublesex- and mab-3-related transcription factor 1QRVMAAqVALR
A346H Mgat3Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferaseQPGTLEVVSGcTmDmLQAVYGLDGIR
A347E Spats2lSPATS2-like proteinmAELnTHVnIK
A347E Spats2lSPATS2-like proteinKMAELNTHVNIK
A347E Spats2lSPATS2-like proteinmAELnTHVnIK
A347E Spats2lSPATS2-like proteinqnGPSSQRR
A347E Spats2lSPATS2-like proteinmAELnTHVnIK
A347E Spats2lSPATS2-like proteinqnGPSSQRR
A347E Spats2lSPATS2-like proteinqnGPSSQRR
A347I Scfd2Sec1 family domain-containing protein 2nLMRqFK
A3482 Plxna1Plexin-A1APSIDNPKR
A3482 Plxna1Plexin-A1LcVNDPK
A3492 NbeaNeurobeachinLLAqMEInDSTR
A3492 NbeaNeurobeachincFLGSSETADANR
A3492 NbeaNeurobeachinLASSIAFSYNAK
A3492 NbeaNeurobeachinGFqHcVKYDFQPR
A3496 Flot1Flotillin-1EmLAAAcQmFLGK
A3500 Prkg2cGMP-dependent protein kinase 2WLNGFnWEGLK
A3500 Prkg2cGMP-dependent protein kinase 2NGINDIK
A3505 Mark2Serine/threonine-protein kinase MARK2TQLnSSSLqK
A3505 Mark2Serine/threonine-protein kinase MARK2TQLnSSSLQK
A3505 Mark2Serine/threonine-protein kinase MARK2KVLDAnScqSELHER
A3505 Mark2Serine/threonine-protein kinase MARK2TQLNSSSLQK
A3505 Mark2Serine/threonine-protein kinase MARK2TQLnSSSLqK
A3505 Mark2Serine/threonine-protein kinase MARK2TQLnSSSLQK
A3505 Mark2Serine/threonine-protein kinase MARK2KVLDAnScqSELHER
A3505 Mark2Serine/threonine-protein kinase MARK2ISGTSmAFK
A3505 Mark2Serine/threonine-protein kinase MARK2TQLnSSSLqK
A3505 Mark2Serine/threonine-protein kinase MARK2TQLnSSSLQK
A3505 Mark2Serine/threonine-protein kinase MARK2KVLDAnScqSELHER
A3505 Mark2Serine/threonine-protein kinase MARK2ISGTSmAFK
A3505 Mark2Serine/threonine-protein kinase MARK2TQLNSSSLQK
A3509 Sbf1Myotubularin-related protein 5MqGAPPAVK
A3509 Sbf1Myotubularin-related protein 5TLSRnLMK
A350F Anapc4Anaphase-promoting complex subunit 4VWSFPPNESTGK
A350F Anapc4Anaphase-promoting complex subunit 4LLESMRAqYVAGnGLR
A3515 37500Septin-2LTVVDTPGYGDAINcR
A3515 37500Septin-2LTVVDTPGYGDAINcR
A3515 37500Septin-2LTVVDTPGYGDAINcR
A3515 37500Septin-2LTVVDTPGYGDAINcR
A351E Srbd1S1 RNA-binding domain-containing protein 1ELINNLDADFLR
A351E Srbd1S1 RNA-binding domain-containing protein 1VKIQAENAEPK
A351E Srbd1S1 RNA-binding domain-containing protein 1VLnVDIPRSR
A351E Srbd1S1 RNA-binding domain-containing protein 1TFcSqHTDSSGqSQETAmVTnEKLGK
A351E Srbd1S1 RNA-binding domain-containing protein 1EKNGPFInR
A351E Srbd1S1 RNA-binding domain-containing protein 1HGcKLAIISPTSQILHTDVVYLHcGQGFR
A351E Srbd1S1 RNA-binding domain-containing protein 1ADATLIPNPLDQTcIHPESYDIAVR
A351J Atad3ATPase family AAA domain-containing protein 3ISVLEALR
A351J Atad3ATPase family AAA domain-containing protein 3VQDAVQQHQqK
A351J Atad3ATPase family AAA domain-containing protein 3QQQLLNEENLR
A351J Atad3ATPase family AAA domain-containing protein 3VFDWASTSR
A351J Atad3ATPase family AAA domain-containing protein 3HPIQVSR
A351J Atad3ATPase family AAA domain-containing protein 3DIAIATR
A351J Atad3ATPase family AAA domain-containing protein 3LVSRPQDALEGVILSPSLEAR
A351J Atad3ATPase family AAA domain-containing protein 3ISVLEALR
A351J Atad3ATPase family AAA domain-containing protein 3QQQLLNEENLR
A352C Rbp3Retinol-binding protein 3KSVAILTSGVTAGAAEEFTYImK
A3530 Arhgap39Rho GTPase-activating protein 39VIFEnTRK
A3530 Arhgap39Rho GTPase-activating protein 39EMSFLRVLIqHLDTSFMEGVL
A3530 Arhgap39Rho GTPase-activating protein 39RAELSGNcSPLLIqPR
A3530 Arhgap39Rho GTPase-activating protein 39GLKKPNVEEIR
A3530 Arhgap39Rho GTPase-activating protein 39FLSLEYSPVGK
A3530 Arhgap39Rho GTPase-activating protein 39QLVYVEQAGSSPKLR
A3531 Ktn1KinectinAqQSLNSIHSK
A3531 Ktn1KinectinnAEQAATQLK
A3531 Ktn1KinectinMQKSIHVK
A3531 Ktn1KinectinKnAEqAATQLK
A3531 Ktn1KinectinEDAAASKER
A3531 Ktn1KinectinEEQVnSMKAALEDR
A3531 Ktn1KinectinDVVEQmEKcIqEK
A3531 Ktn1KinectinDVqnMnFLLK
A3531 Ktn1KinectinDMENLR
A3531 Ktn1KinectinQNEELNLLK
A3531 Ktn1KinectinTVQALKqEIEVLK
A3531 Ktn1KinectinSVEELLEVELLK
A3531 Ktn1KinectinqnEELNLLKTQLnETHSK
A3531 Ktn1KinectinAqQSLNSIHSK
A3531 Ktn1KinectinAqQSLNSIHSK
A3531 Ktn1KinectinnAEQAATQLK
A3531 Ktn1KinectinMQKSIHVK
A3531 Ktn1KinectinKnAEqAATQLK
A3531 Ktn1KinectinEDAAASKER
A3531 Ktn1KinectinEEQVnSMKAALEDR
A3531 Ktn1KinectinDVVEQmEKcIqEK
A3531 Ktn1KinectinDVqnMnFLLK
A3531 Ktn1KinectinDMENLR
A3531 Ktn1KinectinTVQALKqEIEVLK
A3531 Ktn1KinectinSVEELLEVELLK
A3531 Ktn1KinectinAqQSLNSIHSK
A3531 Ktn1KinectinnAEQAATQLK
A3531 Ktn1KinectinMQKSIHVK
A3531 Ktn1KinectinKnAEqAATQLK
A3531 Ktn1KinectinEDAAASKER
A3531 Ktn1KinectinEEQVnSMKAALEDR
A3531 Ktn1KinectinDVVEQmEKcIqEK
A3531 Ktn1KinectinTVQALKqEIEVLK
A3531 Ktn1KinectinSVEELLEVELLK
A3531 Ktn1KinectinAqQSLNSIHSK
A3531 Ktn1KinectinnAEQAATQLK
A3531 Ktn1KinectinMQKSIHVK
A3531 Ktn1KinectinKnAEqAATQLK
A3531 Ktn1KinectinEEQVnSMKAALEDR
A3531 Ktn1KinectinDMENLR
A3531 Ktn1KinectinSVEELLEVELLK
A3531 Ktn1KinectinAqQSLNSIHSK
A3531 Ktn1KinectinnAEQAATQLK
A3531 Ktn1KinectinMQKSIHVK
A3531 Ktn1KinectinKnAEqAATQLK
A3531 Ktn1KinectinEEQVnSMKAALEDR
A3531 Ktn1KinectinDMENLR
A3531 Ktn1KinectinSVEELLEVELLK
A3531 Ktn1KinectinAqQSLNSIHSK
A3531 Ktn1KinectinnAEQAATQLK
A3531 Ktn1KinectinMQKSIHVK
A3531 Ktn1KinectinKnAEqAATQLK
A3531 Ktn1KinectinEDAAASKER
A3531 Ktn1KinectinDVVEQmEKcIqEK
A3531 Ktn1KinectinDVqnMnFLLK
A3531 Ktn1KinectinDMENLR
A3531 Ktn1KinectinQNEELNLLK
A3531 Ktn1KinectinTVQALKqEIEVLK
A3531 Ktn1KinectinSVEELLEVELLK
A3531 Ktn1KinectinqnEELNLLKTQLnETHSK
A3531 Ktn1KinectinqLTqEmMTEK
A3531 Ktn1KinectinAqQSLNSIHSK
A3531 Ktn1KinectinnAEQAATQLK
A3531 Ktn1KinectinMQKSIHVK
A3531 Ktn1KinectinKnAEqAATQLK
A3531 Ktn1KinectinEDAAASKER
A3531 Ktn1KinectinEEQVnSMKAALEDR
A3531 Ktn1KinectinDVVEQmEKcIqEK
A3531 Ktn1KinectinTVQALKqEIEVLK
A3531 Ktn1KinectinSVEELLEVELLK
A3531 Ktn1KinectinqLTqEmMTEK
A3531 Ktn1KinectinAqQSLNSIHSK
A3531 Ktn1KinectinnAEQAATQLK
A3531 Ktn1KinectinMQKSIHVK
A3531 Ktn1KinectinKnAEqAATQLK
A3531 Ktn1KinectinEDAAASKER
A3531 Ktn1KinectinEEQVnSMKAALEDR
A3531 Ktn1KinectinDVVEQmEKcIqEK
A3531 Ktn1KinectinDVqnMnFLLK
A3531 Ktn1KinectinDMENLR
A3531 Ktn1KinectinQNEELNLLK
A3531 Ktn1KinectinTVQALKqEIEVLK
A3531 Ktn1KinectinSVEELLEVELLK
A3531 Ktn1KinectinqnEELNLLKTQLnETHSK
A3531 Ktn1KinectinqLTqEmMTEK
A3531 Ktn1KinectinAqQSLNSIHSK
A3531 Ktn1KinectinnAEQAATQLK
A3531 Ktn1KinectinMQKSIHVK
A3531 Ktn1KinectinKnAEqAATQLK
A3531 Ktn1KinectinEDAAASKER
A3531 Ktn1KinectinEEQVnSMKAALEDR
A3531 Ktn1KinectinDVVEQmEKcIqEK
A3531 Ktn1KinectinQNEELNLLK
A3531 Ktn1KinectinSVEELLEVELLK
A3531 Ktn1KinectinqnEELNLLKTQLnETHSK
A3531 Ktn1KinectinqLTqEmMTEK
A3533 Hsph1Heat shock protein 105 kDanNLGAEAPHqNGEcHPNEK
A3533 Hsph1Heat shock protein 105 kDaNAVEEcVYEFR
A3533 Hsph1Heat shock protein 105 kDaIAKFFGK
A3533 Hsph1Heat shock protein 105 kDaQDLPNAEEKPR
A3533 Hsph1Heat shock protein 105 kDaGcALQcAILSPAFK
A3533 Hsph1Heat shock protein 105 kDaNHAAPFSK
A3533 Hsph1Heat shock protein 105 kDaFVVQNVSAQK
A3533 Hsph1Heat shock protein 105 kDaELNNVcEPVVTqPKPKIESPK
A3533 Hsph1Heat shock protein 105 kDanNLGAEAPHqNGEcHPNEK
A3533 Hsph1Heat shock protein 105 kDaQDLPNAEEKPR
A3533 Hsph1Heat shock protein 105 kDaNHAAPFSK
A3533 Hsph1Heat shock protein 105 kDaFVVQNVSAQK
A3535 Dnaja2DnaJ homolog subfamily A member 2TTKLqLSK
A3535 Dnaja2DnaJ homolog subfamily A member 2VIEPGcVR
A3535 Dnaja2DnaJ homolog subfamily A member 2GEGMPQYR
A3535 Dnaja2DnaJ homolog subfamily A member 2VSLEDLYNGK
A3535 Dnaja2DnaJ homolog subfamily A member 2NVLcSAcSGQGGK
A3536 Dnaja1DnaJ homolog subfamily A member 1QISQAYEVLADSK
A3536 Dnaja1DnaJ homolog subfamily A member 1ILEVHIDK
A3536 Dnaja1DnaJ homolog subfamily A member 1cVLNEGMPIYR
A3536 Dnaja1DnaJ homolog subfamily A member 1NVIcDKcEGR
A3536 Dnaja1DnaJ homolog subfamily A member 1KILEVHIDK
A3536 Dnaja1DnaJ homolog subfamily A member 1RGEDLFMcMDIqLVEALcGFQKPIS
A3536 Dnaja1DnaJ homolog subfamily A member 1QISQAYEVLADSK
A3536 Dnaja1DnaJ homolog subfamily A member 1ILEVHIDK
A3536 Dnaja1DnaJ homolog subfamily A member 1NVIcDKcEGR
A3536 Dnaja1DnaJ homolog subfamily A member 1KILEVHIDK
A3538 Cct4T-complex protein 1 subunit deltaALIAGGGAPEIELALR
A3538 Cct4T-complex protein 1 subunit deltaTLSGMESYcVR
A3538 Cct4T-complex protein 1 subunit deltaLVIEEAER
A3538 Cct4T-complex protein 1 subunit deltaFSNISAAK
A3538 Cct4T-complex protein 1 subunit deltaLTEYSR
A3538 Cct4T-complex protein 1 subunit deltaQMQVLHPAAR
A3538 Cct4T-complex protein 1 subunit deltaGDVTITNDGATILK
A3538 Cct4T-complex protein 1 subunit deltaTGcNVLLIQK
A3538 Cct4T-complex protein 1 subunit deltaDKPAQIRFSnISAAK
A3538 Cct4T-complex protein 1 subunit deltaMIQDGKGDVTITNDGATILK
A3538 Cct4T-complex protein 1 subunit deltaLGGTIDDcELVEGLVLTQK
A3538 Cct4T-complex protein 1 subunit deltaMLVELSK
A3538 Cct4T-complex protein 1 subunit deltaIDDVVNTR
A3538 Cct4T-complex protein 1 subunit deltaVIDPATATSVDLR
A3538 Cct4T-complex protein 1 subunit deltaALIAGGGAPEIELALR
A3538 Cct4T-complex protein 1 subunit deltaTLSGMESYcVR
A3538 Cct4T-complex protein 1 subunit deltaLVIEEAER
A3538 Cct4T-complex protein 1 subunit deltaTGcNVLLIQK
A3538 Cct4T-complex protein 1 subunit deltaDKPAQIRFSnISAAK
A3538 Cct4T-complex protein 1 subunit deltaLGGTIDDcELVEGLVLTQK
A3538 Cct4T-complex protein 1 subunit deltaMLVELSK
A3538 Cct4T-complex protein 1 subunit deltaIDDVVNTR
A3538 Cct4T-complex protein 1 subunit deltaVIDPATATSVDLR
A3539 Cct7T-complex protein 1 subunit etaATISNDGATILK
A3539 Cct7T-complex protein 1 subunit etaTLVDIAK
A3539 Cct7T-complex protein 1 subunit etaQLcDNAGFDATNILNK
A3539 Cct7T-complex protein 1 subunit etaSTVDPPAPSAGR
A3539 Cct7T-complex protein 1 subunit etaTATQLAVNK
A3539 Cct7T-complex protein 1 subunit etaLLDVVHPAAK
A3539 Cct7T-complex protein 1 subunit etacAMTALSSK
A3539 Cct7T-complex protein 1 subunit etaTFSYAGFEMQPK
A3539 Cct7T-complex protein 1 subunit etaVHTVEDYQAIVDAEWNILYDKLEK
A3539 Cct7T-complex protein 1 subunit etaTcTIILR
A3539 Cct7T-complex protein 1 subunit etaLPIGDVATQYFADR
A3541 Tcp1T-complex protein 1 subunit alphaSLLVIPNTLAVNAAQDSTDLVAK
A3541 Tcp1T-complex protein 1 subunit alphaDcLINAAK
A3541 Tcp1T-complex protein 1 subunit alphaIcDDELILIK
A3541 Tcp1T-complex protein 1 subunit alphaAFHNEAQVNPER
A3541 Tcp1T-complex protein 1 subunit alphaSLLVIPNTLAVNAAqDSTDLVAK
A3541 Tcp1T-complex protein 1 subunit alphaLGVQVVITDPEKLDQIR
A3541 Tcp1T-complex protein 1 subunit alphaDDKHGSYENAVHSGALDD
A3541 Tcp1T-complex protein 1 subunit alphaYINENLIINTDELGR
A3541 Tcp1T-complex protein 1 subunit alphaFATEAAITILR
A3541 Tcp1T-complex protein 1 subunit alphaSSFGPVGLDK
A3541 Tcp1T-complex protein 1 subunit alphaLLEVEHPAAK
A3541 Tcp1T-complex protein 1 subunit alphaEQLAIAEFAR
A3541 Tcp1T-complex protein 1 subunit alphaSLLVIPNTLAVNAAQDSTDLVAK
A3541 Tcp1T-complex protein 1 subunit alphaDcLINAAK
A3541 Tcp1T-complex protein 1 subunit alphaIcDDELILIK
A3541 Tcp1T-complex protein 1 subunit alphaAFHNEAQVNPER
A3541 Tcp1T-complex protein 1 subunit alphaSLLVIPNTLAVNAAqDSTDLVAK
A3541 Tcp1T-complex protein 1 subunit alphaLGVQVVITDPEKLDQIR
A3541 Tcp1T-complex protein 1 subunit alphaDDKHGSYENAVHSGALDD
A3541 Tcp1T-complex protein 1 subunit alphaYINENLIINTDELGR
A3541 Tcp1T-complex protein 1 subunit alphaFATEAAITILR
A3541 Tcp1T-complex protein 1 subunit alphaLLEVEHPAAK
A3541 Tcp1T-complex protein 1 subunit alphaEQLAIAEFAR
A3541 Tcp1T-complex protein 1 subunit alphaLLEVEHPAAK
A3542 Cct8T-complex protein 1 subunit thetaQITSYGETcPGLEQYAIK
A3542 Cct8T-complex protein 1 subunit thetaDVDEVSSLLR
A3542 Cct8T-complex protein 1 subunit thetaTAYGPNGMNK
A3542 Cct8T-complex protein 1 subunit thetaLYSVHQEGNK
A3542 Cct8T-complex protein 1 subunit thetaELEVQHPAAK
A3542 Cct8T-complex protein 1 subunit thetaTAYGPNGMnK
A3542 Cct8T-complex protein 1 subunit thetaHEKEDGAISTIVLR
A3542 Cct8T-complex protein 1 subunit thetaAPGFAqmLK
A3542 Cct8T-complex protein 1 subunit thetaTAEELMNFSK
A3542 Cct8T-complex protein 1 subunit thetaGEENLMDAQVK
A3542 Cct8T-complex protein 1 subunit thetaNVGLDIEAEVPAVK
A3542 Cct8T-complex protein 1 subunit thetaHFSGLEEAVYR
A3542 Cct8T-complex protein 1 subunit thetaQYGSETFLAK
A3542 Cct8T-complex protein 1 subunit thetaAVDDGVNTFK
A3542 Cct8T-complex protein 1 subunit thetaLFVTNDAATILR
A3542 Cct8T-complex protein 1 subunit thetaIAVYScPFDGMITETK
A3542 Cct8T-complex protein 1 subunit thetaFAEAFEAIPR
A3542 Cct8T-complex protein 1 subunit thetaNIqAcKELAQTTR
A3543 Cct5T-complex protein 1 subunit epsilonVLVDInNPEPLIQTAK
A3543 Cct5T-complex protein 1 subunit epsilonLMVELSK
A3543 Cct5T-complex protein 1 subunit epsilonESNPALGIDcLHK
A3543 Cct5T-complex protein 1 subunit epsilonVLVDINNPEPLIQTAK
A3543 Cct5T-complex protein 1 subunit epsilonLMGLEALK
A3543 Cct5T-complex protein 1 subunit epsilonIAIQHLDK
A3543 Cct5T-complex protein 1 subunit epsilonEKFEEMIK
A3543 Cct5T-complex protein 1 subunit epsilonFSELTSEK
A3543 Cct5T-complex protein 1 subunit epsilonQMAEIAVNAVLTVADMER
A3543 Cct5T-complex protein 1 subunit epsilonTSLGPNGLDK
A3543 Cct5T-complex protein 1 subunit epsilonWVGGPEIELIAIATGGR
A3543 Cct5T-complex protein 1 subunit epsilonIADGYEQAAR
A3543 Cct5T-complex protein 1 subunit epsilonLGFAGVVQEISFGTTK
A3544 Cct3T-complex protein 1 subunit gammaAVAQALEVIPR
A3544 Cct3T-complex protein 1 subunit gammaISTPVDVNNR
A3544 Cct3T-complex protein 1 subunit gammaEMMLSIINSSITTK
A3544 Cct3T-complex protein 1 subunit gammaTIADIIR
A3544 Cct3T-complex protein 1 subunit gammaTVQFEENGR
A3544 Cct3T-complex protein 1 subunit gammaYARVEK
A3544 Cct3T-complex protein 1 subunit gammaAcTILLR
A3544 Cct3T-complex protein 1 subunit gammaAMTGVEQWPYR
A3544 Cct3T-complex protein 1 subunit gammaSMIEISR
A3544 Cct3T-complex protein 1 subunit gammaEIqVQHPAAK
A3544 Cct3T-complex protein 1 subunit gammaMALDDMISTLK
A3544 Cct3T-complex protein 1 subunit gammaIVSRPEELREDDVGTGAGLLEIK
A3544 Cct3T-complex protein 1 subunit gammaIVLLDSSLEYK
A3544 Cct3T-complex protein 1 subunit gammaTVqFEEnGRK
A3544 Cct3T-complex protein 1 subunit gammaMLLDPMGGIVMTNDGNAILR
A3544 Cct3T-complex protein 1 subunit gammaELGIWEPLAVK
A3544 Cct3T-complex protein 1 subunit gammaTAVETAVLLLR
A3544 Cct3T-complex protein 1 subunit gammaIPGGIIEDScVLR
A3544 Cct3T-complex protein 1 subunit gammaNLQDAMQVcR
A3544 Cct3T-complex protein 1 subunit gammaNVLLDPQLVPGGGASEMAVAHALTEK
A3544 Cct3T-complex protein 1 subunit gammaAVAQALEVIPR
A3544 Cct3T-complex protein 1 subunit gammaISTPVDVNNR
A3544 Cct3T-complex protein 1 subunit gammaTIADIIR
A3544 Cct3T-complex protein 1 subunit gammaYARVEK
A3544 Cct3T-complex protein 1 subunit gammaAcTILLR
A3544 Cct3T-complex protein 1 subunit gammaAMTGVEQWPYR
A3544 Cct3T-complex protein 1 subunit gammaSMIEISR
A3544 Cct3T-complex protein 1 subunit gammaEIqVQHPAAK
A3544 Cct3T-complex protein 1 subunit gammaMALDDMISTLK
A3544 Cct3T-complex protein 1 subunit gammaIVSRPEELREDDVGTGAGLLEIK
A3544 Cct3T-complex protein 1 subunit gammaIVLLDSSLEYK
A3544 Cct3T-complex protein 1 subunit gammaTVqFEEnGRK
A3544 Cct3T-complex protein 1 subunit gammaMLLDPMGGIVMTNDGNAILR
A3544 Cct3T-complex protein 1 subunit gammaELGIWEPLAVK
A3544 Cct3T-complex protein 1 subunit gammaIPGGIIEDScVLR
A3544 Cct3T-complex protein 1 subunit gammaNLQDAMQVcR
A3544 Cct3T-complex protein 1 subunit gammaNVLLDPQLVPGGGASEMAVAHALTEK
A3544 Cct3T-complex protein 1 subunit gammaAVAQALEVIPR
A3544 Cct3T-complex protein 1 subunit gammaISTPVDVNNR
A3544 Cct3T-complex protein 1 subunit gammaTVQFEENGR
A3544 Cct3T-complex protein 1 subunit gammaAcTILLR
A3544 Cct3T-complex protein 1 subunit gammaAMTGVEQWPYR
A3544 Cct3T-complex protein 1 subunit gammaSMIEISR
A3544 Cct3T-complex protein 1 subunit gammaMALDDMISTLK
A3544 Cct3T-complex protein 1 subunit gammaIVLLDSSLEYK
A3544 Cct3T-complex protein 1 subunit gammaELGIWEPLAVK
A3544 Cct3T-complex protein 1 subunit gammaTAVETAVLLLR
A3544 Cct3T-complex protein 1 subunit gammaIPGGIIEDScVLR
A3544 Cct3T-complex protein 1 subunit gammaNLQDAMQVcR
A3544 Cct3T-complex protein 1 subunit gammaNVLLDPQLVPGGGASEMAVAHALTEK
A354G Fam196bProtein FAM196BSISIQTSPSLRK
A355A DtnbDystrobrevin betaLLKEEEqK
A355A DtnbDystrobrevin betaLLKEEEqK
A3560 Ndufa10NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrialTEVLNYTTIPVYLPEITIGAHQGSR
A3560 Ndufa10NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrialYAPGYNAEVGDK
A3560 Ndufa10NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrialVITVDGNIcSGK
A3560 Ndufa10NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrialEIAQQLGMK
A3560 Ndufa10NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrialQcVDHYNEIK
A3560 Ndufa10NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrialKQcVDHYNEIK
A3560 Ndufa10NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrialKLHEYSR
A3560 Ndufa10NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrialQcVDHYNEIKR
A3560 Ndufa10NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrialHYPEAGIQYSSTTTGDGRPLDIEFSGScSLEK
A3560 Ndufa10NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrialVTSAYLQDIENAYKK
A3560 Ndufa10NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrialLQSWLYASR
A3560 Ndufa10NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrialMLVQDKTEVLNYTTIPVYLPEITIGAHQGSR
A3560 Ndufa10NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrialQDDWTFHYLR
A3560 Ndufa10NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrialIYNSFR
A3560 Ndufa10NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrialVTSAYLQDIENAYK
A3560 Ndufa10NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrialVVEDIEYLK
A3560 Ndufa10NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrialLTLPEYLPPHAVIYIDVPVPEVQSR
A3560 Ndufa10NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrialLLQYADALEHLLSTGQGVVLER
A3566 Psmd1426S proteasome non-ATPase regulatory subunit 14HNESVVKEmLELAK
A3566 Psmd1426S proteasome non-ATPase regulatory subunit 14VVIDAFR
A3566 Psmd1426S proteasome non-ATPase regulatory subunit 14HNESVVKEmLELAK
A3566 Psmd1426S proteasome non-ATPase regulatory subunit 14VVIDAFR
A3567 Psma4Proteasome subunit alpha type-4TTIFSPEGR
A3567 Psma4Proteasome subunit alpha type-4LLDEVFFSEK
A3567 Psma4Proteasome subunit alpha type-4SALALAVK
A3567 Psma4Proteasome subunit alpha type-4VEIATLTR
A3567 Psma4Proteasome subunit alpha type-4TTIFSPEGR
A3567 Psma4Proteasome subunit alpha type-4LLDEVFFSEK
A3567 Psma4Proteasome subunit alpha type-4SALALAVK
A3567 Psma4Proteasome subunit alpha type-4TTIFSPEGR
A3567 Psma4Proteasome subunit alpha type-4LLDEVFFSEK
A3568 Psmd126S proteasome non-ATPase regulatory subunit 1cIDHYTK
A3568 Psmd126S proteasome non-ATPase regulatory subunit 1VLSMTETcR
A3569 Psmd826S proteasome non-ATPase regulatory subunit 8HPVSLEQYLMEGSYNK
A3569 Psmd826S proteasome non-ATPase regulatory subunit 8VAEFHTELER
A356C Rab11fip5Rab11 family-interacting protein 5NnLSASMFDLSmKDKPR
A356C Rab11fip5Rab11 family-interacting protein 5ImETSPTLLQISPGPPK
A356C Rab11fip5Rab11 family-interacting protein 5NnLSASMFDLSmKDKPR
A356C Rab11fip5Rab11 family-interacting protein 5ImETSPTLLQISPGPPK
A3580 Cyfip2Cytoplasmic FMR1-interacting protein 2GLqLLSK
A3580 Cyfip2Cytoplasmic FMR1-interacting protein 2GLqLLSK
A3584 FasnFatty acid synthaseGNAGQTNYGFANSTmER
A3584 FasnFatty acid synthaseVGDPQELNGITR
A3584 FasnFatty acid synthaseHFqLEqDKPK
A3584 FasnFatty acid synthaseSFDDSGSGYcR
A3584 FasnFatty acid synthaseLSPDAIPGK
A3584 FasnFatty acid synthaseVQEVQQVSTNK
A3584 FasnFatty acid synthaseAQVEDAFR
A3584 FasnFatty acid synthaseTGTVALEVR
A3584 FasnFatty acid synthaseSDEAVKPLGVK
A3584 FasnFatty acid synthaseHFQLEQDKPK
A3584 FasnFatty acid synthaseLDPGSPELQQVLK
A3584 FasnFatty acid synthaseYNGTLnLDRATR
A3584 FasnFatty acid synthaseVYLWEDPNSK
A3588 PygbGlycogen phosphorylase, brain formVLYPNDNFFEGK
A3588 PygbGlycogen phosphorylase, brain formNLAENISR
A3588 PygbGlycogen phosphorylase, brain formqEYFVVAATLQDIIR
A358H Mapk11Mitogen-activated protein kinase 11QELNKTVWEVPQR
A3590 OmgOligodendrocyte-myelin glycoproteinAHVIGTPcSK
A3590 OmgOligodendrocyte-myelin glycoproteinGMPnNFSEmPRQSTTLNLR
A3590 OmgOligodendrocyte-myelin glycoproteinAHVIGTPcSK
A3590 OmgOligodendrocyte-myelin glycoproteinGMPnNFSEmPRQSTTLNLR
A359C Rftn1RaftlinNEIHGRqTR
A359C Rftn1RaftlinESKFQWR
A359C Rftn1RaftlinNEIHGRqTR
A359C Rftn1RaftlinESKFQWR
A359D Fam136aProtein FAM136AMAEVqQLR
A359D Fam136aProtein FAM136AVQEAVDAMVK
A359I Sel1l3Protein sel-1 homolog 3LAQMLFWGQqGVAK
A359I Sel1l3Protein sel-1 homolog 3HPISVSTVILR
A359I Sel1l3Protein sel-1 homolog 3HPISVSTVILR
A359I Sel1l3Protein sel-1 homolog 3LAQMLFWGQqGVAK
A359I Sel1l3Protein sel-1 homolog 3HPISVSTVILR
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialIMDQAITVGAPVIGLNDSGGAR
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialTVGIVGNQPNVASGcLDINSSVK
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialIccDLEVLASK
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialEFFNFLPLSSQDPAPIR
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialEFFEIMPSYAK
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialFPGDSVVTGR
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialGAVEIIFK
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialNKFPGDSVVTGR
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialIQEGVESLAGYADIFLR
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialDTSYLFITGPEVVK
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialNIVVGFAR
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialAYGGAYDVMSSK
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialGHQDVEAAQAEYVEK
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialcADFGMAADK
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialGFVDDIIQPSSTR
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialSVTNEDVTQEQLGGAK
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialAFDNDVDALcNLR
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialHLLGDTNYAWPTAEIAVMGAK
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialLVPELDTVVPLESSK
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialAYNMLDIIHAVIDER
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialISLLLDPGSFMESDMFVEHR
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialIMDQAITVGAPVIGLNDSGGAR
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialEFFNFLPLSSQDPAPIR
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialIQEGVESLAGYADIFLR
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialDTSYLFITGPEVVK
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialSVTNEDVTQEQLGGAK
A3602 PccbPropionyl-CoA carboxylase beta chain, mitochondrialAFDNDVDALcNLR
A3605 Crmp1Dihydropyrimidinase-related protein 1WHEAADTK
A3605 Crmp1Dihydropyrimidinase-related protein 1IVAPPGGR
A3605 Crmp1Dihydropyrimidinase-related protein 1MDENQFVAVTSTNAAK
A3605 Crmp1Dihydropyrimidinase-related protein 1IVAPPGGRSNITSLG
A3607 NptnNeuroplastinIVTSEEVIIR
A3607 NptnNeuroplastinSENKNEGQDAMMYcK
A3607 NptnNeuroplastinNGVELTATR
A3607 NptnNeuroplastinAEDSGEYHcVYHFVSAPK
A3609 DpysDihydropyrimidinaseMDEnRFVAVTSTNAAK
A3609 DpysDihydropyrimidinaseFVAVTSTNAAK
A360A E2f8Transcription factor E2F8AASVnSRK
A3628 Ankrd53Ankyrin repeat domain-containing protein 53KGAAINSQTYNGSTPLHLAScNGLLGcIK
A3628 Ankrd53Ankyrin repeat domain-containing protein 53KGAAINSQTYNGSTPLHLAScNGLLGcIK
A3628 Ankrd53Ankyrin repeat domain-containing protein 53VLAQTLGSADSK
A3628 Ankrd53Ankyrin repeat domain-containing protein 53EQPRPSVQGGTRqAEHDLK
A3634 Comtd1Catechol O-methyltransferase domain-containing protein 1VVTcEVDAEPPK
A363F Arap2Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2SFSFTADSER
A364C Rhbdf2Inactive rhomboid protein 2DQqIEqLVRR
A364C Rhbdf2Inactive rhomboid protein 2QASLSqSIR
A364C Rhbdf2Inactive rhomboid protein 2KDqqIEqLVR
A3651 Dhrs7bDehydrogenase/reductase SDR family member 7BYGALDKNTAQGR
A3651 Dhrs7bDehydrogenase/reductase SDR family member 7BYGALDKNTAQGR
A3652 D1Pas1Putative ATP-dependent RNA helicase Pl10LVDMMER
A3652 D1Pas1Putative ATP-dependent RNA helicase Pl10DLMAcAQTGSGK
A3652 D1Pas1Putative ATP-dependent RNA helicase Pl10VGSTSENITQK
A3652 D1Pas1Putative ATP-dependent RNA helicase Pl10LEQELFSGGNTGINFEK
A3652 D1Pas1Putative ATP-dependent RNA helicase Pl10IGLDFcK
A3652 D1Pas1Putative ATP-dependent RNA helicase Pl10DREEALHQFR
A3652 D1Pas1Putative ATP-dependent RNA helicase Pl10mLDmGFEPqIR
A3652 D1Pas1Putative ATP-dependent RNA helicase Pl10DKDAYSSFGSR
A3652 D1Pas1Putative ATP-dependent RNA helicase Pl10GLDISNVK
A3652 D1Pas1Putative ATP-dependent RNA helicase Pl10YLVLDEADR
A3652 D1Pas1Putative ATP-dependent RNA helicase Pl10HVINFDLPSDIEEYVHR
A3652 D1Pas1Putative ATP-dependent RNA helicase Pl10MLDMGFEPQIR
A3652 D1Pas1Putative ATP-dependent RNA helicase Pl10DLLDLLVEAK
A3653 Ddx3xATP-dependent RNA helicase DDX3XLVDMMER
A3653 Ddx3xATP-dependent RNA helicase DDX3XDLMAcAQTGSGK
A3653 Ddx3xATP-dependent RNA helicase DDX3XVGSTSENITQK
A3653 Ddx3xATP-dependent RNA helicase DDX3XLEQELFSGGNTGINFEK
A3653 Ddx3xATP-dependent RNA helicase DDX3XHAIPIIK
A3653 Ddx3xATP-dependent RNA helicase DDX3XIGLDFcK
A3653 Ddx3xATP-dependent RNA helicase DDX3XDREEALHQFR
A3653 Ddx3xATP-dependent RNA helicase DDX3XQEVPSWLENMAFEHHYK
A3653 Ddx3xATP-dependent RNA helicase DDX3XVVWVEEIDKR
A3653 Ddx3xATP-dependent RNA helicase DDX3XmLDmGFEPqIR
A3653 Ddx3xATP-dependent RNA helicase DDX3XDKDAYSSFGSR
A3653 Ddx3xATP-dependent RNA helicase DDX3XGLDISNVK
A3653 Ddx3xATP-dependent RNA helicase DDX3XYLVLDEADR
A3653 Ddx3xATP-dependent RNA helicase DDX3XHVINFDLPSDIEEYVHR
A3653 Ddx3xATP-dependent RNA helicase DDX3XMLDMGFEPQIR
A3653 Ddx3xATP-dependent RNA helicase DDX3XDLLDLLVEAK
A3654 Ddx3yATP-dependent RNA helicase DDX3YLVDMMER
A3654 Ddx3yATP-dependent RNA helicase DDX3YDLMAcAQTGSGK
A3654 Ddx3yATP-dependent RNA helicase DDX3YnDYDGIGGRDR
A3654 Ddx3yATP-dependent RNA helicase DDX3YVGSTSENITQK
A3654 Ddx3yATP-dependent RNA helicase DDX3YLEQELFSGGNTGINFEK
A3654 Ddx3yATP-dependent RNA helicase DDX3YHAIPIIK
A3654 Ddx3yATP-dependent RNA helicase DDX3YIGLDFcK
A3654 Ddx3yATP-dependent RNA helicase DDX3YDREEALHQFR
A3654 Ddx3yATP-dependent RNA helicase DDX3YVVWVEELDKR
A3654 Ddx3yATP-dependent RNA helicase DDX3YmLDmGFEPqIR
A3654 Ddx3yATP-dependent RNA helicase DDX3YDKDAYSSFGSR
A3654 Ddx3yATP-dependent RNA helicase DDX3YGLDISNVK
A3654 Ddx3yATP-dependent RNA helicase DDX3YYLVLDEADR
A3654 Ddx3yATP-dependent RNA helicase DDX3YHVINFDLPSDIEEYVHR
A3654 Ddx3yATP-dependent RNA helicase DDX3YMLDMGFEPQIR
A3654 Ddx3yATP-dependent RNA helicase DDX3YDLLDLLVEAK
A3655 Ddx4Probable ATP-dependent RNA helicase DDX4DLMAcAQTGSGK
A3655 Ddx4Probable ATP-dependent RNA helicase DDX4YLVLDEADR
A3656 Ddx1ATP-dependent RNA helicase DDX1ALIVEPSR
A365D Zc2hc1bZinc finger C2HC domain-containing protein 1BLQGTDIPTVGKSPQPK
A365D Zc2hc1bZinc finger C2HC domain-containing protein 1BLQGTDIPTVGKSPQPK
A365D Zc2hc1bZinc finger C2HC domain-containing protein 1BLQGTDIPTVGKSPQPK
A3667 Gpd2Glycerol-3-phosphate dehydrogenase, mitochondrialVIFFLPWEK
A3667 Gpd2Glycerol-3-phosphate dehydrogenase, mitochondrialAIMNLDVEQYR
A3667 Gpd2Glycerol-3-phosphate dehydrogenase, mitochondrialLVQDYGLESEVAQHLAK
A3667 Gpd2Glycerol-3-phosphate dehydrogenase, mitochondrialcKDVLTGQEFDVR
A3667 Gpd2Glycerol-3-phosphate dehydrogenase, mitochondrialLAFLNVQAAEEALPR
A3667 Gpd2Glycerol-3-phosphate dehydrogenase, mitochondrialEAqLmTLK
A3667 Gpd2Glycerol-3-phosphate dehydrogenase, mitochondrialSMAEDTVDAAVK
A3667 Gpd2Glycerol-3-phosphate dehydrogenase, mitochondrialELNWSELR
A3667 Gpd2Glycerol-3-phosphate dehydrogenase, mitochondrialALEHFPMLQK
A3667 Gpd2Glycerol-3-phosphate dehydrogenase, mitochondrialMnLAIALTAAR
A3667 Gpd2Glycerol-3-phosphate dehydrogenase, mitochondrialnGqVELHEFLQLmSAVqKGR
A3678 PmpcaMitochondrial-processing peptidase subunit alphaDTTMYAVSADSK
A3678 PmpcaMitochondrial-processing peptidase subunit alphaVTTLDNGLRVASqnK
A3678 PmpcaMitochondrial-processing peptidase subunit alphaDTTMYAVSADSK
A3678 PmpcaMitochondrial-processing peptidase subunit alphaVTTLDNGLRVASqnK
A368F Arhgef3Rho guanine nucleotide exchange factor 3FSQTLqRSISFR
A368F Arhgef3Rho guanine nucleotide exchange factor 3VqDFLqR
A369A TsfmElongation factor Ts, mitochondrial precursorFQQLVQQVALGTMAHcqNLTDR
A369A TsfmElongation factor Ts, mitochondrial precursorQAQKEGWSK
A369A TsfmElongation factor Ts, mitochondrial precursorALETcGGDLK
A369A TsfmElongation factor Ts, mitochondrial precursorLGQHVVGMAPLSVGSLDDEPGGETETR
A369A TsfmElongation factor Ts, mitochondrial precursorFQQLVQQVALGTMAHcqNLTDR
A369A TsfmElongation factor Ts, mitochondrial precursorQAQKEGWSK
A369A TsfmElongation factor Ts, mitochondrial precursorALETcGGDLK
A3707 Hsd17b11Estradiol 17-beta-dehydrogenase 11ALTDELAALGR
A3707 Hsd17b11Estradiol 17-beta-dehydrogenase 11LTAYEFAK
A370I Senp6Sentrin-specific protease 6ILFDEAnSR
A370I Senp6Sentrin-specific protease 6DQLGnSISTPLK
A370I Senp6Sentrin-specific protease 6DVMKGSnPK
A370I Senp6Sentrin-specific protease 6DVMKGSnPK
A370I Senp6Sentrin-specific protease 6ILFDEAnSR
A370I Senp6Sentrin-specific protease 6DQLGnSISTPLK
A370I Senp6Sentrin-specific protease 6DVMKGSnPK
A3710 Rdh10Retinol dehydrogenase 10ENVYLTAER
A3713 Cbr4Carbonyl reductase family member 4NLEVAKVTAGELGGNHLAFR
A3713 Cbr4Carbonyl reductase family member 4VcAVFGGSR
A3713 Cbr4Carbonyl reductase family member 4GNVGQSAYSATK
A3713 Cbr4Carbonyl reductase family member 4VcAVFGGSR
A3717 Hsd11b2Corticosteroid 11-beta-dehydrogenase isozyme 2ELLQAYGEDYIEHVHGQFLNSLR
A3717 Hsd11b2Corticosteroid 11-beta-dehydrogenase isozyme 2AVLITGcDTGFGK
A3717 Hsd11b2Corticosteroid 11-beta-dehydrogenase isozyme 2ALRPGQHGPAPA
A3717 Hsd11b2Corticosteroid 11-beta-dehydrogenase isozyme 2ALRPGqHGPAPA
A3717 Hsd11b2Corticosteroid 11-beta-dehydrogenase isozyme 2LLQMDLTK
A3717 Hsd11b2Corticosteroid 11-beta-dehydrogenase isozyme 2TDAVTNVNLWEK
A371I Senp7Sentrin-specific protease 7DImmEISTK
A371I Senp7Sentrin-specific protease 7ANEFIFLELnSSISQR
A371I Senp7Sentrin-specific protease 7DImmEISTK
A371I Senp7Sentrin-specific protease 7ANEFIFLELnSSISQR
A371I Senp7Sentrin-specific protease 7LHSLLVR
A371I Senp7Sentrin-specific protease 7nPPASASqVLGLK
A3724 Rdh7Retinol dehydrogenase 7VLAAcLTEK
A3724 Rdh7Retinol dehydrogenase 7TSDRLETVILDVTK
A3724 Rdh7Retinol dehydrogenase 7YSAGWDAK
A3724 Rdh7Retinol dehydrogenase 7LETVILDVTK
A3726 Hsd17b617-beta-hydroxysteroid dehydrogenase type 6VLAAcLTEK
A3726 Hsd17b617-beta-hydroxysteroid dehydrogenase type 6TSDRLETVILDVTK
A3726 Hsd17b617-beta-hydroxysteroid dehydrogenase type 6YSAGWDAK
A3726 Hsd17b617-beta-hydroxysteroid dehydrogenase type 6LETVILDVTK
A3738 Slc25a30Kidney mitochondrial carrier protein 1LQIqGQTNDAnFR
A3738 Slc25a30Kidney mitochondrial carrier protein 1TRLqIqGqTnDANFR
A3739 Slc25a35Solute carrier family 25 member 35LYNQPTDTR
A373C S100a13Protein S100-A13TLDVNQDSELR
A373D Fam178aProtein FAM178AMSLEKELK
A373D Fam178aProtein FAM178AEPIIPKAR
A373D Fam178aProtein FAM178AESSGnSNAGSnALK
A373D Fam178aProtein FAM178AMSLEKELK
A373D Fam178aProtein FAM178AESSGnSNAGSnALK
A373D Fam178aProtein FAM178AEPIIPKAR
A373D Fam178aProtein FAM178AESSGnSNAGSnALK
A373D Fam178aProtein FAM178AMSLEKELK
A373D Fam178aProtein FAM178AEPIIPKAR
A373D Fam178aProtein FAM178AESSGnSNAGSnALK
A3746 Slc25a21Mitochondrial 2-oxodicarboxylate carrierIQGPQPVPGEIK
A374E Tanc2Protein TANC2ALELKPK
A374E Tanc2Protein TANC2nGqcALVHAALR
A374E Tanc2Protein TANC2YqSSqGDmGVSqSR
A374E Tanc2Protein TANC2LGFLLGEK
A3752 Slc25a15Mitochondrial ornithine transporter 1TYSQVGFR
A3752 Slc25a15Mitochondrial ornithine transporter 1GLTDccLK
A3752 Slc25a15Mitochondrial ornithine transporter 1LQTMYEMETSGK
A3752 Slc25a15Mitochondrial ornithine transporter 1KVVGLDQQAK
A3752 Slc25a15Mitochondrial ornithine transporter 1VVGLDQQAK
A3752 Slc25a15Mitochondrial ornithine transporter 1MQTFPDLYR
A3752 Slc25a15Mitochondrial ornithine transporter 1IQVLSmTGK
A3752 Slc25a15Mitochondrial ornithine transporter 1IQVLSMTGK
A3754 Slc25a29Mitochondrial carnitine/acylcarnitine carrier protein CACLGMVSTLLR
A375F Arl5bADP-ribosylation factor-like protein 5BNTHFLmWDIGGqESLR
A375F Arl5bADP-ribosylation factor-like protein 5BNTHFLmWDIGGqESLR
A375H Moap1Modulator of apoptosis 1YLTTYqKTDEK
A375H Moap1Modulator of apoptosis 1APMLAqALnEALKPTLQYLRYK
A375H Moap1Modulator of apoptosis 1EIPAKGGVWR
A3761 Slc25a41Solute carrier family 25 member 41VLPAGGISYLVYEAMK
A3761 Slc25a41Solute carrier family 25 member 41ILSQQGWPGLYR
A3761 Slc25a41Solute carrier family 25 member 41IAPEYAIKFSVcEQSK
A3761 Slc25a41Solute carrier family 25 member 41VLPAGGISYLVYEAMK
A3761 Slc25a41Solute carrier family 25 member 41ILSQQGWPGLYR
A3761 Slc25a41Solute carrier family 25 member 41IAPEYAIKFSVcEQSK
A376A Eif3bEukaryotic translation initiation factor 3 subunit BLSqSKASK
A376A Eif3bEukaryotic translation initiation factor 3 subunit BTSIFWNDVKDPVSIEER
A376A Eif3bEukaryotic translation initiation factor 3 subunit BGYIFLEYASPAHAVDAVK
A376A Eif3bEukaryotic translation initiation factor 3 subunit BMTLDTLSIYETPSMGLLDKK
A376A Eif3bEukaryotic translation initiation factor 3 subunit BLSqSKASK
A376A Eif3bEukaryotic translation initiation factor 3 subunit BTSIFWNDVKDPVSIEER
A376A Eif3bEukaryotic translation initiation factor 3 subunit BNGDYLcVK
A376A Eif3bEukaryotic translation initiation factor 3 subunit BSPSQEPSAPGKAEAVGEQAR
A376A Eif3bEukaryotic translation initiation factor 3 subunit BGYIFLEYASPAHAVDAVK
A376A Eif3bEukaryotic translation initiation factor 3 subunit BMTLDTLSIYETPSMGLLDKK
A377G Fam91a1Protein FAM91A1NQYIDLMnQcRSSK
A377G Fam91a1Protein FAM91A1SPSSLLIASLHL
A3780 Iars2Isoleucine--tRNA ligase, mitochondrialSLGNVINPDTIISGGK
A3780 Iars2Isoleucine--tRNA ligase, mitochondrialSFAQAAIEK
A3780 Iars2Isoleucine--tRNA ligase, mitochondrialKPGLEEAVESAcAMR
A3780 Iars2Isoleucine--tRNA ligase, mitochondrialVIVVPTAR
A3780 Iars2Isoleucine--tRNA ligase, mitochondrialDSFLGSIPGK
A3780 Iars2Isoleucine--tRNA ligase, mitochondrialHTSETADALcPR
A3780 Iars2Isoleucine--tRNA ligase, mitochondrialQQSDMELEIQQK
A3780 Iars2Isoleucine--tRNA ligase, mitochondrialLYcEnEKDPK
A3780 Iars2Isoleucine--tRNA ligase, mitochondrialTKDEYLINSQTTEHIIK
A3780 Iars2Isoleucine--tRNA ligase, mitochondrialFLLGNLTGFNPETDSVPVK
A3780 Iars2Isoleucine--tRNA ligase, mitochondrialFIPGAALNSMTDMLDR
A3780 Iars2Isoleucine--tRNA ligase, mitochondrialSFAQAAIEK
A3780 Iars2Isoleucine--tRNA ligase, mitochondrialQQSDMELEIQQK
A3780 Iars2Isoleucine--tRNA ligase, mitochondrialTKDEYLINSQTTEHIIK
A3787 Krt19Keratin, type I cytoskeletal 19IVLQIDNAR
A3787 Krt19Keratin, type I cytoskeletal 19LAADDFR
A378C Slc12a6Solute carrier family 12 member 6ESAAmLnnMR
A378C Slc12a6Solute carrier family 12 member 6VKSmEGFQDLLNMRPDQSNVR
A378C Slc12a6Solute carrier family 12 member 6ESAAmLnnMR
A378C Slc12a6Solute carrier family 12 member 6VKSmEGFQDLLNMRPDQSNVR
A378C Slc12a6Solute carrier family 12 member 6mPHFTVTK
A3791 Orc2Origin recognition complex subunit 2APLVNNNK
A3791 Orc2Origin recognition complex subunit 2VLGRNIQESLGnGSAK
A3791 Orc2Origin recognition complex subunit 2FVPSFSAEIER
A3791 Orc2Origin recognition complex subunit 2AQLTEFRDHK
A3791 Orc2Origin recognition complex subunit 2EKAQLLVNPqK
A3791 Orc2Origin recognition complex subunit 2APLVNNNK
A3791 Orc2Origin recognition complex subunit 2AQLTEFRDHK
A3794 MecrTrans-2-enoyl-CoA reductase, mitochondrialNLELTAVEGSDVHVRmLAAPInPSDINMIqGnYGLLPK
A3794 MecrTrans-2-enoyl-CoA reductase, mitochondrialHLAPGGTmVTYGGMAK
A3794 MecrTrans-2-enoyl-CoA reductase, mitochondrialNLELTAVEGSDVHVR
A3794 MecrTrans-2-enoyl-CoA reductase, mitochondrialLALNcVGGK
A3794 MecrTrans-2-enoyl-CoA reductase, mitochondrialALVYGNHGDPAK
A3794 MecrTrans-2-enoyl-CoA reductase, mitochondrialDIPLQSAATLGVNPcTAYR
A3794 MecrTrans-2-enoyl-CoA reductase, mitochondrialLKDLGADYVLTEEELR
A3796 PurbTranscriptional activator protein Pur-betaFYLDVK
A3797 PurgPurine-rich element-binding protein gammaFYLDVK
A3797 PurgPurine-rich element-binding protein gammaFYLDVK
A3806 Eif4bEukaryotic translation initiation factor 4BDGNKVDVVGATQGQAGScSR
A3806 Eif4bEukaryotic translation initiation factor 4BDSDKTDTDWR
A380A Eif3gEukaryotic translation initiation factor 3 subunit GETDLQELFRPFGSISR
A380E Tecpr1Tectonin beta-propeller repeat-containing protein 1QIFQqLTERTK
A380E Tecpr1Tectonin beta-propeller repeat-containing protein 1QIFQqLTERTK
A380E Tecpr1Tectonin beta-propeller repeat-containing protein 1KVHGRPSPqAIWSVTcK
A381A Eif3hEukaryotic translation initiation factor 3 subunit HKEGTGSTATSSGSAGGAVGK
A381A Eif3hEukaryotic translation initiation factor 3 subunit HEGTGSTATSSGSAGGAVGK
A381A Eif3hEukaryotic translation initiation factor 3 subunit HKEGTGSTATSSGSAGGAVGK
A381A Eif3hEukaryotic translation initiation factor 3 subunit HEGTGSTATSSGSAGGAVGK
A381F Armcx6Protein ARMCX6ANRAHPIK
A381F Armcx6Protein ARMCX6AnRAHPIK
A381F Armcx6Protein ARMCX6qRPFPYEHK
A3826 Krt27Keratin, type I cytoskeletal 27TVVEELDPRGK
A3826 Krt27Keratin, type I cytoskeletal 27GQGRPGNqTKDSPK
A3832 Krt35Keratin, type I cuticular Ha5QLVEADINGLR
A3832 Krt35Keratin, type I cuticular Ha5qLEqENASLESR
A3832 Krt35Keratin, type I cuticular Ha5LAADDFR
A3837 Krt32Keratin, type I cuticular Ha2qQLGDRLnIEVDAAPPVDLTR
A3837 Krt32Keratin, type I cuticular Ha2VLLDVKAR
A3837 Krt32Keratin, type I cuticular Ha2LAADDFR
A383F Actr10Actin-related protein 10SISKEYYnQTGR
A3848 Krt7Keratin, type II cytoskeletal 7LQAEIDTLK
A3848 Krt7Keratin, type II cytoskeletal 7FETLQAQAGK
A3848 Krt7Keratin, type II cytoskeletal 7EYQELLNTK
A3848 Krt7Keratin, type II cytoskeletal 7SAYGGPVGAGIR
A384G Fam50aProtein FAM50AAMHLMKK
A3853 Krt71Keratin, type II cytoskeletal 71AEAEALYQTK
A3853 Krt71Keratin, type II cytoskeletal 71QFTcKSGASnR
A3853 Krt71Keratin, type II cytoskeletal 71NNLEPILEGHISNmRK
A3853 Krt71Keratin, type II cytoskeletal 71FLEQQNQVLQTK
A385A Eif3lEukaryotic translation initiation factor 3 subunit LEPFLQQLK
A385C Slc15a2Solute carrier family 15 member 2AEDIPAnK
A385C Slc15a2Solute carrier family 15 member 2DTGIKPANGmTAIRFInTLHK
A385C Slc15a2Solute carrier family 15 member 2NNPLLVESISSFqNTTHYSK
A385H Morc4MORC family CW-type zinc finger protein 4ITFGFScK
A385H Morc4MORC family CW-type zinc finger protein 4WFcYYNPHPK
A385H Morc4MORC family CW-type zinc finger protein 4HTEEnR
A385H Morc4MORC family CW-type zinc finger protein 4KVTTqmIAK
A385H Morc4MORC family CW-type zinc finger protein 4ITFGFScK
A385H Morc4MORC family CW-type zinc finger protein 4WFcYYNPHPK
A385H Morc4MORC family CW-type zinc finger protein 4HTEEnR
A385H Morc4MORC family CW-type zinc finger protein 4KVTTqmIAK
A3866 Epb41l2Band 4.1-like protein 2TEMVTISDASqR
A3866 Epb41l2Band 4.1-like protein 2HqASISELKR
A3866 Epb41l2Band 4.1-like protein 2TEMVTISDASQR
A3866 Epb41l2Band 4.1-like protein 2FLTLGSK
A3866 Epb41l2Band 4.1-like protein 2VcEHLNLLEK
A3866 Epb41l2Band 4.1-like protein 2SNFYIK
A3866 Epb41l2Band 4.1-like protein 2nFmASTPEPRPSEWEK
A3866 Epb41l2Band 4.1-like protein 2GLSPAQADSQFLENAKR
A3866 Epb41l2Band 4.1-like protein 2TEMVTISDASqR
A3866 Epb41l2Band 4.1-like protein 2HqASISELKR
A3866 Epb41l2Band 4.1-like protein 2TEMVTISDASQR
A3866 Epb41l2Band 4.1-like protein 2nFmASTPEPRPSEWEK
A3867 Epb41l1Band 4.1-like protein 1GMTPGEAEIHFLENAK
A3867 Epb41l1Band 4.1-like protein 1DQSPVILK
A3867 Epb41l1Band 4.1-like protein 1SNFYIK
A3867 Epb41l1Band 4.1-like protein 1LVSPEPPPK
A3867 Epb41l1Band 4.1-like protein 1ELEERImELHK
A3867 Epb41l1Band 4.1-like protein 1QASALIDRPAPFFER
A3867 Epb41l1Band 4.1-like protein 1AqRTSTqqqGK
A3867 Epb41l1Band 4.1-like protein 1AQRTSTqqqGK
A3867 Epb41l1Band 4.1-like protein 1SNFYIK
A3867 Epb41l1Band 4.1-like protein 1VSAADSTQVDGGTPMVK
A3867 Epb41l1Band 4.1-like protein 1LVSPEPPPK
A3867 Epb41l1Band 4.1-like protein 1ELEERImELHK
A3867 Epb41l1Band 4.1-like protein 1QASALIDRPAPFFER
A3867 Epb41l1Band 4.1-like protein 1GMTPGEAEIHFLENAK
A3867 Epb41l1Band 4.1-like protein 1SNFYIK
A3867 Epb41l1Band 4.1-like protein 1VSAADSTQVDGGTPMVK
A3867 Epb41l1Band 4.1-like protein 1LVSPEPPPK
A3867 Epb41l1Band 4.1-like protein 1ELEERImELHK
A3867 Epb41l1Band 4.1-like protein 1QASALIDRPAPFFER
A3867 Epb41l1Band 4.1-like protein 1FLDKPEDVLLK
A386A Eif3mEukaryotic translation initiation factor 3 subunit MLLTFmGmAVENK
A386A Eif3mEukaryotic translation initiation factor 3 subunit MLQLLSNLFHGmDKnTPVR
A3872 Fmnl3Formin-like protein 3LKQMLEIILALGNYmNSSK
A3872 Fmnl3Formin-like protein 3LVSQKDDVHVcILcLR
A3872 Fmnl3Formin-like protein 3LLDLENENMMRVAELEK
A3872 Fmnl3Formin-like protein 3VAELEKqLLqR
A3872 Fmnl3Formin-like protein 3LKQMLEIILALGNYmNSSK
A3872 Fmnl3Formin-like protein 3SIEDLqPPnALSAPFTNSLAR
A3872 Fmnl3Formin-like protein 3LVSQKDDVHVcILcLR
A3872 Fmnl3Formin-like protein 3LLDLENENMMRVAELEK
A3872 Fmnl3Formin-like protein 3VAELEKqLLqR
A3873 Ank2Ankyrin-2HSPVSSLK
A3873 Ank2Ankyrin-2mEDPVRER
A3873 Ank2Ankyrin-2TDLVAEVASMRSR
A3873 Ank2Ankyrin-2VALLLLEK
A3873 Ank2Ankyrin-2HSPVSSLK
A3873 Ank2Ankyrin-2mEDPVRER
A3873 Ank2Ankyrin-2TDLVAEVASMRSR
A3873 Ank2Ankyrin-2HSPVSSLK
A3873 Ank2Ankyrin-2mEDPVRER
A3873 Ank2Ankyrin-2MmNEDAAqKSDSGEK
A3873 Ank2Ankyrin-2SYIETETESR
A3873 Ank2Ankyrin-2ELMKAFqSGQDPSK
A3873 Ank2Ankyrin-2VALLLLEK
A3873 Ank2Ankyrin-2TDLVAEVASMRSR
A3879 Erc2ERC protein 2mYGSARTISnLEGSPSR
A3879 Erc2ERC protein 2DTKIASLER
A3879 Erc2ERC protein 2EHASSLASAGLK
A3879 Erc2ERC protein 2LLEMLQSK
A3879 Erc2ERC protein 2ALQTVIEMK
A3879 Erc2ERC protein 2mYGSARTISnLEGSPSR
A3879 Erc2ERC protein 2DTKIASLER
A3879 Erc2ERC protein 2KTqEEVMALK
A3879 Erc2ERC protein 2EHASSLASAGLK
A3879 Erc2ERC protein 2LLEMLQSK
A3879 Erc2ERC protein 2DLNHLLqQESGNR
A3879 Erc2ERC protein 2ALQTVIEMK
A3879 Erc2ERC protein 2QIEVYK
A3879 Erc2ERC protein 2DTKIASLER
A3879 Erc2ERC protein 2ALQTVIEMK
A3879 Erc2ERC protein 2QIEVYK
A387I FrzbSecreted frizzled-related protein 3ASLVNIPR
A3885 Ncam2Neural cell adhesion molecule 2NGKLIEEnEK
A3885 Ncam2Neural cell adhesion molecule 2NGKLIEEnEK
A3885 Ncam2Neural cell adhesion molecule 2NGKLIEEnEK
A389E Tex9Testis-expressed sequence 9 proteinDLLAREqEYK
A389E Tex9Testis-expressed sequence 9 proteinTVTSqqSQIEKYK
A389E Tex9Testis-expressed sequence 9 proteinDNqYLnNDLERR
A389E Tex9Testis-expressed sequence 9 proteinDLLAREqEYK
A389E Tex9Testis-expressed sequence 9 proteinTVTSqqSQIEKYK
A3900 Lin7cProtein lin-7 homolog CVLEEMESR
A3900 Lin7cProtein lin-7 homolog CTEEGLGFNIMGGK
A3900 Lin7cProtein lin-7 homolog CAIELLEK
A3900 Lin7cProtein lin-7 homolog CLQALQRVLQSEFcNAVR
A3900 Lin7cProtein lin-7 homolog CEQNSPIYISR
A3905 Syt7Synaptotagmin-7FSRnDPIGEVSIPLnK
A3905 Syt7Synaptotagmin-7qPVAQWHQLKA
A3905 Syt7Synaptotagmin-7VLYLqVLDYDR
A3905 Syt7Synaptotagmin-7QPVAqWHQLK
A3905 Syt7Synaptotagmin-7FSRnDPIGEVSIPLnK
A3905 Syt7Synaptotagmin-7qPVAQWHQLKA
A3905 Syt7Synaptotagmin-7VLYLqVLDYDR
A3905 Syt7Synaptotagmin-7QPVAqWHQLK
A3905 Syt7Synaptotagmin-7DFWnNnESTVQqK
A3905 Syt7Synaptotagmin-7FSRnDPIGEVSIPLnK
A3905 Syt7Synaptotagmin-7qPVAQWHQLKA
A3905 Syt7Synaptotagmin-7VLYLqVLDYDR
A3906 Hip1rHuntingtin-interacting protein 1-related proteinESqEQGLRQK
A3906 Hip1rHuntingtin-interacting protein 1-related proteinALqLEGAR
A3906 Hip1rHuntingtin-interacting protein 1-related proteinFcHVLHK
A3906 Hip1rHuntingtin-interacting protein 1-related proteinILNScTDLMK
A3906 Hip1rHuntingtin-interacting protein 1-related proteinSLDVRqEELGAmVDK
A3906 Hip1rHuntingtin-interacting protein 1-related proteinmEAqRYISqLK
A3906 Hip1rHuntingtin-interacting protein 1-related proteinVKEQLAFqmEqAK
A3910 NapbBeta-soluble NSF attachment proteinAIEIYEQVGAnTmDnPLLKYSAK
A3914 Nipsnap1Protein NipSnap homolog 1IQFHNVKPEcLDAYNSLTEAVLPK
A3914 Nipsnap1Protein NipSnap homolog 1SKMLLSR
A3914 Nipsnap1Protein NipSnap homolog 1KETSNLYK
A3914 Nipsnap1Protein NipSnap homolog 1LHLDEDYPcSLVGNWNTWYGEQDQAVHLWR
A3914 Nipsnap1Protein NipSnap homolog 1FSGGYPALMDcMNK
A3914 Nipsnap1Protein NipSnap homolog 1GWDENVYYTVPLVR
A3914 Nipsnap1Protein NipSnap homolog 1NQLLLEFSFWNEPQPR
A3914 Nipsnap1Protein NipSnap homolog 1AGPNIYELR
A391A Elp4Elongator complex protein 4ELEDVHSAKTPEPNVNmK
A391A Elp4Elongator complex protein 4IAWRYqLqPK
A391A Elp4Elongator complex protein 4SSKqDLAASTAR
A391A Elp4Elongator complex protein 4LLSIAGTRPSVR
A391A Elp4Elongator complex protein 4GLLRSSLSAcIITmPAHLVQNK
A3923 Exoc8Exocyst complex component 8GMYRYnALYPLDR
A3923 Exoc8Exocyst complex component 8RMnLMTPEALGK
A3936 Gosr1Golgi SNAP receptor complex member 1MAEYTHSAGVPSLNAALmHTLQR
A3936 Gosr1Golgi SNAP receptor complex member 1QLEnELDLK
A3936 Gosr1Golgi SNAP receptor complex member 1LIEETISIAMATKEnMTSqR
A3938 VapbVesicle-associated membrane protein-associated protein BVEQVLSLEPQHELK
A3938 VapbVesicle-associated membrane protein-associated protein BnVcFKVK
A3938 VapbVesicle-associated membrane protein-associated protein BSLTSPLDDTEVKK
A3938 VapbVesicle-associated membrane protein-associated protein BEAKPEDLMDSK
A393A Epc1Enhancer of polycomb homolog 1LAAAANcQVSK
A393A Epc1Enhancer of polycomb homolog 1YEKKPK
A393A Epc1Enhancer of polycomb homolog 1MEHHLqRAISAQQVYGEK
A3940 Stx7Syntaxin-7ITQcSVEIQR
A3940 Stx7Syntaxin-7QQYTNQLAK
A3940 Stx7Syntaxin-7VSGGFPEDSSK
A3940 Stx7Syntaxin-7EFGSLPTTPSEQR
A3946 Abcd3ATP-binding cassette sub-family D member 3GISDQVLK
A3946 Abcd3ATP-binding cassette sub-family D member 3SGANVLIcGPNGcGK
A3946 Abcd3ATP-binding cassette sub-family D member 3LITNSEEIAFYnGNKR
A3946 Abcd3ATP-binding cassette sub-family D member 3SGANVLIcGPnGcGK
A3946 Abcd3ATP-binding cassette sub-family D member 3MSQALGR
A3946 Abcd3ATP-binding cassette sub-family D member 3SGKPPLQNNEK
A3946 Abcd3ATP-binding cassette sub-family D member 3GIEGAQASPLVPGAGEIINTDNIIK
A3946 Abcd3ATP-binding cassette sub-family D member 3KITEDTVEFGS
A3946 Abcd3ATP-binding cassette sub-family D member 3DQVIYPDGKEDQK
A3946 Abcd3ATP-binding cassette sub-family D member 3YLYEEYLQAFTYYK
A3946 Abcd3ATP-binding cassette sub-family D member 3LITNSEEIAFYNGNK
A3946 Abcd3ATP-binding cassette sub-family D member 3EGGWDSVQDWMDVLSGGEK
A3946 Abcd3ATP-binding cassette sub-family D member 3IANPDQLLTQDVEK
A3946 Abcd3ATP-binding cassette sub-family D member 3EYLDNVQLGHILER
A3946 Abcd3ATP-binding cassette sub-family D member 3MTIMEQK
A3946 Abcd3ATP-binding cassette sub-family D member 3HLHSTHSELLEDYYQSGR
A3946 Abcd3ATP-binding cassette sub-family D member 3FDHVPLATPNGDILIQDLSFEVR
A3947 Abcb8ATP-binding cassette sub-family B member 8, mitochondrialVVqEALDRASAGR
A3947 Abcb8ATP-binding cassette sub-family B member 8, mitochondrialIVALVGqSGGGK
A394B  UPF0420 protein C16orf58 homologSRNQVQVALSQEAGPETVLR
A3950 Tomm70aMitochondrial import receptor subunit TOM70AAAFEQLQK
A3950 Tomm70aMitochondrial import receptor subunit TOM70NVDLSTFYQNRAAAFEQLQK
A3950 Tomm70aMitochondrial import receptor subunit TOM70QAYTANNSSQVQAAMK
A3950 Tomm70aMitochondrial import receptor subunit TOM70GLELISK
A3950 Tomm70aMitochondrial import receptor subunit TOM70FALAQAQK
A3950 Tomm70aMitochondrial import receptor subunit TOM70EAnVKLR
A3953 Sfxn2Sideroflexin-2TVFASEQELDWAK
A3953 Sfxn2Sideroflexin-2nQNELGHSQR
A3953 Sfxn2Sideroflexin-2NAASPTSVR
A3953 Sfxn2Sideroflexin-2WDqcTFLGRVK
A3953 Sfxn2Sideroflexin-2LYDSAFHPDTGEK
A3953 Sfxn2Sideroflexin-2KLYDSAFHPDTGEK
A3953 Sfxn2Sideroflexin-2MGLVPPGTQMEQLLYAK
A3953 Sfxn2Sideroflexin-2QQELIQGIcVK
A3956 Mtx1Metaxin-1YNADYDLSAR
A3956 Mtx1Metaxin-1EKYNADYDLSAR
A3956 Mtx1Metaxin-1NYVEVTR
A3956 Mtx1Metaxin-1DGDEVPLPR
A3956 Mtx1Metaxin-1cPTSHSPAAAqAAK
A3956 Mtx1Metaxin-1EcLTLLSQR
A3956 Mtx1Metaxin-1DGDEVPLPR
A3956 Mtx1Metaxin-1DGDEVPLPR
A3956 Mtx1Metaxin-1DGDEVPLPR
A3956 Mtx1Metaxin-1NYVEVTR
A3956 Mtx1Metaxin-1DGDEVPLPR
A3956 Mtx1Metaxin-1cPTSHSPAAAqAAK
A3956 Mtx1Metaxin-1EcLTLLSQR
A3956 Mtx1Metaxin-1DGDEVPLPR
A3956 Mtx1Metaxin-1KEYNADYDLSAR
A3956 Mtx1Metaxin-1NYVEVTR
A3956 Mtx1Metaxin-1DGDEVPLPR
A3956 Mtx1Metaxin-1cPTSHSPAAAqAAK
A3956 Mtx1Metaxin-1EcLTLLSQR
A3956 Mtx1Metaxin-1DGDEVPLPR
A3956 Mtx1Metaxin-1YNADYDLSAR
A3956 Mtx1Metaxin-1EKYNADYDLSAR
A3956 Mtx1Metaxin-1NYVEVTR
A3956 Mtx1Metaxin-1DGDEVPLPR
A3956 Mtx1Metaxin-1EcLTLLSQR
A3956 Mtx1Metaxin-1DGDEVPLPR
A3960 Myo6Unconventional myosin-VIIVEANPLLEAFGNAK
A3960 Myo6Unconventional myosin-VIILKEEQELYQK
A3960 Myo6Unconventional myosin-VIFVEIHFNEK
A3960 Myo6Unconventional myosin-VIMSQSIIVSGESGAGK
A3960 Myo6Unconventional myosin-VIALGLNEVDYK
A3960 Myo6Unconventional myosin-VIETDKQILQNR
A3960 Myo6Unconventional myosin-VINLRDDEGFIIR
A3960 Myo6Unconventional myosin-VIQFEEIWER
A3960 Myo6Unconventional myosin-VISSEDLLSALQK
A3960 Myo6Unconventional myosin-VIVMLTTAGGTK
A3960 Myo6Unconventional myosin-VILcAGASEDIREK
A3960 Myo6Unconventional myosin-VILQQFFNER
A3960 Myo6Unconventional myosin-VIDTINTScDIELLAAcR
A3960 Myo6Unconventional myosin-VILcAGASEDIR
A3960 Myo6Unconventional myosin-VINLEISIDALMAK
A3960 Myo6Unconventional myosin-VIQREEESQQQAVLAQEcR
A3960 Myo6Unconventional myosin-VIGcTRFFAnK
A3960 Myo6Unconventional myosin-VIcGGIQYLQSAIESR
A3960 Myo6Unconventional myosin-VIIYSSDTIK
A3960 Myo6Unconventional myosin-VIFAEFDQIMK
A3960 Myo6Unconventional myosin-VINNDALHMSLESLIcESR
A3960 Myo6Unconventional myosin-VIFIRALFESSTNnSK
A3960 Myo6Unconventional myosin-VImKLEMEPK
A3960 Myo6Unconventional myosin-VIIVEANPLLEAFGNAK
A3960 Myo6Unconventional myosin-VISTMMTREqIqK
A3960 Myo6Unconventional myosin-VIILKEEQELYQK
A3960 Myo6Unconventional myosin-VISVTDYAQQNPAAQLPAR
A3960 Myo6Unconventional myosin-VIFVEIHFNEK
A3960 Myo6Unconventional myosin-VIMSQSIIVSGESGAGK
A3960 Myo6Unconventional myosin-VIALGLNEVDYK
A3960 Myo6Unconventional myosin-VIALFESSTNNNKDTK
A3960 Myo6Unconventional myosin-VIETDKQILQNR
A3960 Myo6Unconventional myosin-VINLRDDEGFIIR
A3960 Myo6Unconventional myosin-VIQFEEIWER
A3960 Myo6Unconventional myosin-VIMKLEMEAK
A3960 Myo6Unconventional myosin-VISSEDLLSALQK
A3960 Myo6Unconventional myosin-VIVMLTTAGGTK
A3960 Myo6Unconventional myosin-VIIGLDDEEKLDLFR
A3960 Myo6Unconventional myosin-VILcAGASEDIREK
A3960 Myo6Unconventional myosin-VILQQFFNER
A3960 Myo6Unconventional myosin-VIDTINTScDIELLAAcR
A3960 Myo6Unconventional myosin-VIYLTESYGTGQDIDDR
A3960 Myo6Unconventional myosin-VImKLEmEAK
A3960 Myo6Unconventional myosin-VIHFAGAVcYETTQFVEK
A3960 Myo6Unconventional myosin-VILcAGASEDIR
A3960 Myo6Unconventional myosin-VINLEISIDALMAK
A3960 Myo6Unconventional myosin-VIQREEESQQQAVLAQEcR
A3960 Myo6Unconventional myosin-VIAGSLKDPLLDDHGDFIR
A3960 Myo6Unconventional myosin-VIGcTRFFAnK
A3960 Myo6Unconventional myosin-VIcGGIQYLQSAIESR
A3960 Myo6Unconventional myosin-VIIYSSDTIK
A3960 Myo6Unconventional myosin-VIIQAEVEAQLAR
A3960 Myo6Unconventional myosin-VIFAEFDQIMK
A3960 Myo6Unconventional myosin-VIEMSEILSR
A3960 Myo6Unconventional myosin-VIEGLGVNEVHYVDNQDcIDLIEVK
A3960 Myo6Unconventional myosin-VINNDALHMSLESLIcESR
A3960 Myo6Unconventional myosin-VIVVAGVLHLGNIDFEEAGSTSGGcNLK
A3960 Myo6Unconventional myosin-VIIVEANPLLEAFGNAK
A3960 Myo6Unconventional myosin-VISTMMTREqIqK
A3960 Myo6Unconventional myosin-VIILKEEQELYQK
A3960 Myo6Unconventional myosin-VISVTDYAQQNPAAQLPAR
A3960 Myo6Unconventional myosin-VIFVEIHFNEK
A3960 Myo6Unconventional myosin-VIMSQSIIVSGESGAGK
A3960 Myo6Unconventional myosin-VIALGLNEVDYK
A3960 Myo6Unconventional myosin-VIALFESSTNNNKDTK
A3960 Myo6Unconventional myosin-VIETDKQILQNR
A3960 Myo6Unconventional myosin-VINLRDDEGFIIR
A3960 Myo6Unconventional myosin-VIQFEEIWER
A3960 Myo6Unconventional myosin-VIMKLEMEAK
A3960 Myo6Unconventional myosin-VISSEDLLSALQK
A3960 Myo6Unconventional myosin-VIVMLTTAGGTK
A3960 Myo6Unconventional myosin-VIIGLDDEEKLDLFR
A3960 Myo6Unconventional myosin-VILcAGASEDIREK
A3960 Myo6Unconventional myosin-VILQQFFNER
A3960 Myo6Unconventional myosin-VIDTINTScDIELLAAcR
A3960 Myo6Unconventional myosin-VIYLTESYGTGQDIDDR
A3960 Myo6Unconventional myosin-VIHFAGAVcYETTQFVEK
A3960 Myo6Unconventional myosin-VILcAGASEDIR
A3960 Myo6Unconventional myosin-VINLEISIDALMAK
A3960 Myo6Unconventional myosin-VIQREEESQQQAVLAQEcR
A3960 Myo6Unconventional myosin-VIAGSLKDPLLDDHGDFIR
A3960 Myo6Unconventional myosin-VIGcTRFFAnK
A3960 Myo6Unconventional myosin-VIcGGIQYLQSAIESR
A3960 Myo6Unconventional myosin-VIIYSSDTIK
A3960 Myo6Unconventional myosin-VIIQAEVEAQLAR
A3960 Myo6Unconventional myosin-VIFAEFDQIMK
A3960 Myo6Unconventional myosin-VINNDALHMSLESLIcESR
A3960 Myo6Unconventional myosin-VIVVAGVLHLGNIDFEEAGSTSGGcNLK
A3967 Kif5bKinesin-1 heavy chainNTVcVNVELTAEQWK
A3967 Kif5bKinesin-1 heavy chainVFQSSTSQEQVYNDcAK
A3967 Kif5bKinesin-1 heavy chainHVAVTNMNEHSSR
A3967 Kif5bKinesin-1 heavy chainTNLSVHEDKNR
A3967 Kif5bKinesin-1 heavy chainmVLEqERLR
A3967 Kif5bKinesin-1 heavy chainLYLVDLAGSEK
A3967 Kif5bKinesin-1 heavy chainILqDSLGGncR
A3968 Klc2Kinesin light chain 2KLqGGGPQEPNSR
A3968 Klc2Kinesin light chain 2AVIqGLETLRGEHR
A3968 Klc2Kinesin light chain 2AVIqGLETLRGEHR
A396A Gspt1Eukaryotic peptide chain release factor GTP-binding subunit ERF3AKGEFETGFEK
A396A Gspt1Eukaryotic peptide chain release factor GTP-binding subunit ERF3AMDDPTVnWSnER
A396F Asb18Ankyrin repeat and SOCS box protein 18DTPLHVAAqR
A3970 Clasp2CLIP-associating protein 2VMATSGcAAIR
A3970 Clasp2CLIP-associating protein 2ESFPNDLqFNILMR
A3970 Clasp2CLIP-associating protein 2WVGSSnYR
A3970 Clasp2CLIP-associating protein 2EGLLGLQNLLKNQR
A3970 Clasp2CLIP-associating protein 2NEGSqSAnTIGAGSR
A3970 Clasp2CLIP-associating protein 2mVSQSQRSSSPDK
A3970 Clasp2CLIP-associating protein 2VMATSGcAAIR
A3970 Clasp2CLIP-associating protein 2ESFPNDLqFNILMR
A3970 Clasp2CLIP-associating protein 2EGLLGLQNLLKNQR
A397C Slc22a12Solute carrier family 22 member 12TGSLLLISRLGR
A397C Slc22a12Solute carrier family 22 member 12LDQGLQELQRVAAVnR
A397C Slc22a12Solute carrier family 22 member 12LDQGLQELQR
A397C Slc22a12Solute carrier family 22 member 12KAEGDTLTMEVLR
A397C Slc22a12Solute carrier family 22 member 12KVTHDTPDGSILMSTR
A397C Slc22a12Solute carrier family 22 member 12MTAVGLcQVAAR
A397C Slc22a12Solute carrier family 22 member 12TGSLLLISR
A397C Slc22a12Solute carrier family 22 member 12NLPLPDTIQDIQK
A397C Slc22a12Solute carrier family 22 member 12MTAVGLcqVAAR
A3986 Dock7Dedicator of cytokinesis protein 7ITYFDK
A3986 Dock7Dedicator of cytokinesis protein 7nLLYIYPqSLnFAnR
A3986 Dock7Dedicator of cytokinesis protein 7LGTGFNPnTLDK
A3986 Dock7Dedicator of cytokinesis protein 7ISENFYFDLNSEQMK
A3994 Chchd6Coiled-coil-helix-coiled-coil-helix domain-containing protein 6, mitochondrialVPSAESGGGLQSSAVK
A3994 Chchd6Coiled-coil-helix-coiled-coil-helix domain-containing protein 6, mitochondrialASLTHEQQQSAR
A3994 Chchd6Coiled-coil-helix-coiled-coil-helix domain-containing protein 6, mitochondrialAYQHcVSTAR
A3994 Chchd6Coiled-coil-helix-coiled-coil-helix domain-containing protein 6, mitochondrialVPSAESGGGLQSSAVK
A3994 Chchd6Coiled-coil-helix-coiled-coil-helix domain-containing protein 6, mitochondrialASLTHEQQQSAR
A4006 Efr3aProtein EFR3 homolog ALTVPYVPQVTDEDRLSR
A400E Tpd52l2Tumor protein D54GVLSDFMTDVPVDPGVVHR
A400E Tpd52l2Tumor protein D54TqETLSQAGQK
A400E Tpd52l2Tumor protein D54xINLnSPnK
A400E Tpd52l2Tumor protein D54GVLSDFMTDVPVDPGVVHR
A400E Tpd52l2Tumor protein D54TqETLSQAGQK
A4019 SdhdSuccinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrialAVAMLWK
A4021 Timm8bMitochondrial import inner membrane translocase subunit Tim8 BFAQIVqK
A4021 Timm8bMitochondrial import inner membrane translocase subunit Tim8 BTENcLSScVDR
A4021 Timm8bMitochondrial import inner membrane translocase subunit Tim8 BFIDTTLAITGR
A4023 McuCalcium uniporter protein, mitochondrialqqLAPLEK
A4023 McuCalcium uniporter protein, mitochondrialDPLqVHLPLR
A4023 McuCalcium uniporter protein, mitochondrialqqLAPLEK
A4023 McuCalcium uniporter protein, mitochondrialVAASTGIDLLLLDDFK
A4023 McuCalcium uniporter protein, mitochondrialDPLqVHLPLR
A402A Esr2Estrogen receptor betaSASEqVHcLNKAK
A402A Esr2Estrogen receptor betaSASEqVHcLNKAK
A403C Slc22a21Solute carrier family 22 member 21KPqSHHIYDLVRTPNIR
A403C Slc22a21Solute carrier family 22 member 21NMGVGVSSTASR
A4042 Ppp1ccSerine/threonine-protein phosphatase PP1-gamma catalytic subunitHDLDLIcR
A4042 Ppp1ccSerine/threonine-protein phosphatase PP1-gamma catalytic subunitAHQVVEDGYEFFAK
A4042 Ppp1ccSerine/threonine-protein phosphatase PP1-gamma catalytic subunitGMITKQAK
A4042 Ppp1ccSerine/threonine-protein phosphatase PP1-gamma catalytic subunitTFTDcFNcLPIAAIVDEK
A4042 Ppp1ccSerine/threonine-protein phosphatase PP1-gamma catalytic subunitGNHEcASINR
A4042 Ppp1ccSerine/threonine-protein phosphatase PP1-gamma catalytic subunitNVQLQENEIR
A4042 Ppp1ccSerine/threonine-protein phosphatase PP1-gamma catalytic subunitIcGDIHGQYYDLLR
A4042 Ppp1ccSerine/threonine-protein phosphatase PP1-gamma catalytic subunitIYGFYDEcK
A4042 Ppp1ccSerine/threonine-protein phosphatase PP1-gamma catalytic subunitEIFLSQPILLELEAPLK
A4042 Ppp1ccSerine/threonine-protein phosphatase PP1-gamma catalytic subunitIFccHGGLSPDLQSMEQIR
A4042 Ppp1ccSerine/threonine-protein phosphatase PP1-gamma catalytic subunitnVqLQENEIR
A4042 Ppp1ccSerine/threonine-protein phosphatase PP1-gamma catalytic subunitHDLDLIcR
A4042 Ppp1ccSerine/threonine-protein phosphatase PP1-gamma catalytic subunitAHQVVEDGYEFFAK
A4042 Ppp1ccSerine/threonine-protein phosphatase PP1-gamma catalytic subunitTFTDcFNcLPIAAIVDEK
A4042 Ppp1ccSerine/threonine-protein phosphatase PP1-gamma catalytic subunitNVQLQENEIR
A4042 Ppp1ccSerine/threonine-protein phosphatase PP1-gamma catalytic subunitIcGDIHGQYYDLLR
A4042 Ppp1ccSerine/threonine-protein phosphatase PP1-gamma catalytic subunitIYGFYDEcK
A4042 Ppp1ccSerine/threonine-protein phosphatase PP1-gamma catalytic subunitEIFLSQPILLELEAPLK
A4042 Ppp1ccSerine/threonine-protein phosphatase PP1-gamma catalytic subunitIFccHGGLSPDLQSMEQIR
A4042 Ppp1ccSerine/threonine-protein phosphatase PP1-gamma catalytic subunitnVqLQENEIR
A4043 Ppp1cbSerine/threonine-protein phosphatase PP1-beta catalytic subunitHDLDLIcR
A4043 Ppp1cbSerine/threonine-protein phosphatase PP1-beta catalytic subunitAHQVVEDGYEFFAK
A4043 Ppp1cbSerine/threonine-protein phosphatase PP1-beta catalytic subunitTFTDcFNcLPIAAIVDEK
A4043 Ppp1cbSerine/threonine-protein phosphatase PP1-beta catalytic subunitGNHEcASINR
A4043 Ppp1cbSerine/threonine-protein phosphatase PP1-beta catalytic subunitIcGDIHGQYTDLLR
A4043 Ppp1cbSerine/threonine-protein phosphatase PP1-beta catalytic subunitIYGFYDEcK
A4043 Ppp1cbSerine/threonine-protein phosphatase PP1-beta catalytic subunitEIFLSQPILLELEAPLK
A4043 Ppp1cbSerine/threonine-protein phosphatase PP1-beta catalytic subunitIFccHGGLSPDLQSMEQIR
A4043 Ppp1cbSerine/threonine-protein phosphatase PP1-beta catalytic subunitIVQMTEAEVR
A4043 Ppp1cbSerine/threonine-protein phosphatase PP1-beta catalytic subunitIVqMTEAEVR
A4050 Slc22a5Solute carrier family 22 member 5NMGVGVSSTASR
A4055 Anp32bAcidic leucine-rich nuclear phosphoprotein 32 family member BELVLDNcK
A4055 Anp32bAcidic leucine-rich nuclear phosphoprotein 32 family member BSLDLFGcEVTNR
A4055 Anp32bAcidic leucine-rich nuclear phosphoprotein 32 family member BLAEELPSLTHLNLSGNNLK
A405B Csmd3CUB and sushi domain-containing protein 3LVGKSSAVcR
A405B Csmd3CUB and sushi domain-containing protein 3IGNDFAVGSLVLFEcNPGYILHGSR
A405B Csmd3CUB and sushi domain-containing protein 3LVGKSSAVcR
A405B Csmd3CUB and sushi domain-containing protein 3IGNDFAVGSLVLFEcNPGYILHGSR
A4061 Asz1Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1FLLDRGAnASFDK
A4061 Asz1Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1ELIQKMqnER
A4068 Bub3Mitotic checkpoint protein BUB3TPcNAGTFSQPEK
A4068 Bub3Mitotic checkpoint protein BUB3LNQPPEDGISSVK
A4069 Cables1CDK5 and ABL1 enzyme substrate 1RVLTFPSYmTTVIDYVKPSDLK
A4069 Cables1CDK5 and ABL1 enzyme substrate 1RVLTFPSYmTTVIDYVKPSDLK
A4073 Ccnb3G2/mitotic-specific cyclin-B3LETEKAQSNK
A4073 Ccnb3G2/mitotic-specific cyclin-B3KqQqLPK
A4079 Ccpg1Cell cycle progression protein 1WqKYGR
A4079 Ccpg1Cell cycle progression protein 1KnLAAEnqYLR
A4079 Ccpg1Cell cycle progression protein 1SLKEnLER
A408A Ewsr1Ewing sarcoma breakpoint region 1AAVEWFDGKDFQGSK
A408A Ewsr1Ewing sarcoma breakpoint region 1GGPGGPGGPGGPMGR
A408A Ewsr1Ewing sarcoma breakpoint region 1AAVEWFDGK
A408A Ewsr1Ewing sarcoma breakpoint region 1GDATVSYEDPPTAK
A408A Ewsr1Ewing sarcoma breakpoint region 1QDHPSSMGVYGQESGGFSGPGENR
A408A Ewsr1Ewing sarcoma breakpoint region 1QDHPSSMGVYGQESGGFSGPGENR
A408C Sec23ipSEC23-interacting proteinTMNISPEQPQH
A408I Shc4SHC (Src homology 2 domain containing) family, member 4IQAQATDQMAYcPIR
A408I Shc4SHC (Src homology 2 domain containing) family, member 4IQAQATDqMAYcPIR
A408I Shc4SHC (Src homology 2 domain containing) family, member 4IQAQATDQMAYcPIR
A408I Shc4SHC (Src homology 2 domain containing) family, member 4IQAQATDqMAYcPIR
A4095 Ncapg2Condensin-2 complex subunit G2GLPAKEDMGK
A4095 Ncapg2Condensin-2 complex subunit G2SNLASKR
A4095 Ncapg2Condensin-2 complex subunit G2EVATAVYR
A4095 Ncapg2Condensin-2 complex subunit G2FqMQLLQR
A4102 Cul4aCullin-4AFINLMK
A4102 Cul4aCullin-4ADKDSPNQYHYVA
A4106 Dbf4Protein DBF4 homolog AcGTPVqLqLK
A4106 Dbf4Protein DBF4 homolog AmnLETMR
A4106 Dbf4Protein DBF4 homolog AAGPGIqKTR
A4106 Dbf4Protein DBF4 homolog AcGTPVqLqLK
A4106 Dbf4Protein DBF4 homolog AmnLETMR
A4106 Dbf4Protein DBF4 homolog AAGPGIqKTR
A4107 Dclre1aDNA cross-link repair 1A proteinKGLGAPGAncAcR
A4108 Dlgap5Disks large-associated protein 5SqRFGTPLSASK
A4108 Dlgap5Disks large-associated protein 5mLVSRFASR
A4108 Dlgap5Disks large-associated protein 5SqRFGTPLSASK
A4108 Dlgap5Disks large-associated protein 5mLVSRFASR
A4108 Dlgap5Disks large-associated protein 5QTSEKQPLDR
A4108 Dlgap5Disks large-associated protein 5KVmqPVLFTSGK
A4108 Dlgap5Disks large-associated protein 5mLVSRFASR
A4108 Dlgap5Disks large-associated protein 5QTSEKQPLDR
A4108 Dlgap5Disks large-associated protein 5KVmqPVLFTSGK
A410F Asic3Acid-sensing ion channel 3SGNTLLqEELnGHR
A410F Asic3Acid-sensing ion channel 3TcYLVTRL
A4113 ErhEnhancer of rudimentary homologTYADYESVNEcMEGVcK
A4113 ErhEnhancer of rudimentary homologTYADYESVNEcMEGVcK
A4115 Evi5Ecotropic viral integration site 5 proteinLSPDDLELLAK
A4115 Evi5Ecotropic viral integration site 5 proteinLSPDDLELLAK
A4115 Evi5Ecotropic viral integration site 5 proteinLSPDDLELLAK
A4128 GclmGlutamate--cysteine ligase regulatory subunitQFDIQLLTHNDPK
A4128 GclmGlutamate--cysteine ligase regulatory subunitTLNEWSSQISPDLVR
A4128 GclmGlutamate--cysteine ligase regulatory subunitGYILQAK
A4128 GclmGlutamate--cysteine ligase regulatory subunitINPDEREEMK
A4128 GclmGlutamate--cysteine ligase regulatory subunitEFPDVLEcTMSHAVEK
A412H MrgbpMRG-binding proteinVVIEEEmK
A4138 Kifap3Kinesin-associated protein 3LSIFmEnK
A4138 Kifap3Kinesin-associated protein 3VLREDWK
A4138 Kifap3Kinesin-associated protein 3GGnIDVHPSEK
A4138 Kifap3Kinesin-associated protein 3LSIFmENK
A4141 Kntc1Kinetochore-associated protein 1NFVGTDIIK
A4141 Kntc1Kinetochore-associated protein 1VKLLqESYK
A4141 Kntc1Kinetochore-associated protein 1nFLnScDAR
A4146 TmpoLamina-associated polypeptide 2, isoforms alpha/zetaSELVANNVTLPAGEQR
A4146 TmpoLamina-associated polypeptide 2, isoforms alpha/zetaSELVANNVTLPAGEQR
A414G FbrsProbable fibrosin-1DLPFSRPQLRVSPATPK
A414G FbrsProbable fibrosin-1mEGLFR
A414I Shisa9Protein shisa-9RqAYGNK
A414I Shisa9Protein shisa-9YASLKAVGnSDGDWAVATLK
A4150 Mis18bp1Mis18-binding protein 1nEmIYESPGK
A4150 Mis18bp1Mis18-binding protein 1SKqmLTnDFMK
A4150 Mis18bp1Mis18-binding protein 1nEmIYESPGK
A4150 Mis18bp1Mis18-binding protein 1SKqmLTnDFMK
A4153 McmbpMini-chromosome maintenance complex-binding proteinSDnTLqRALAqSK
A4170 NipblNipped-B-like proteinVSGPLSGnSANHHADNPR
A4170 NipblNipped-B-like proteinNLYNSILSDKnSSVNLK
A4170 NipblNipped-B-like proteinVLELLmYFTK
A4170 NipblNipped-B-like proteinSNKGSIDqSVLK
A4170 NipblNipped-B-like proteinmqQADRDWK
A4170 NipblNipped-B-like proteinKVDQDVVITnSYETAmR
A4173 Nsl1Kinetochore-associated protein NSL1 homologFVqELGAVLPEDVR
A4173 Nsl1Kinetochore-associated protein NSL1 homologFVqELGAVLPEDVR
A4173 Nsl1Kinetochore-associated protein NSL1 homologFVqELGAVLPEDVR
A4174 Nuf2Kinetochore protein Nuf2LSLVSLK
A4174 Nuf2Kinetochore protein Nuf2LSLVSLK
A4178 Pard3bPartitioning defective 3 homolog BINNVELLDK
A4178 Pard3bPartitioning defective 3 homolog BTGIVVPcKDGQLR
A4178 Pard3bPartitioning defective 3 homolog BARPSDHDLR
A4178 Pard3bPartitioning defective 3 homolog BGcNESFR
A4178 Pard3bPartitioning defective 3 homolog BLRmNDQLIAVnGETLLGK
A4178 Pard3bPartitioning defective 3 homolog BSVIGPLNIFGNNDGASR
A4178 Pard3bPartitioning defective 3 homolog BINNVELLDK
A4178 Pard3bPartitioning defective 3 homolog BTGIVVPcKDGQLR
A4178 Pard3bPartitioning defective 3 homolog BGcNESFR
A4178 Pard3bPartitioning defective 3 homolog BSVIGPLNIFGNNDGASR
A4178 Pard3bPartitioning defective 3 homolog BINNVELLDK
A4178 Pard3bPartitioning defective 3 homolog BTGIVVPcKDGQLR
A4178 Pard3bPartitioning defective 3 homolog BARPSDHDLR
A4178 Pard3bPartitioning defective 3 homolog BHITENKIK
A4178 Pard3bPartitioning defective 3 homolog BGcNESFR
A4178 Pard3bPartitioning defective 3 homolog BLRmNDQLIAVnGETLLGK
A4178 Pard3bPartitioning defective 3 homolog BSVIGPLNIFGNNDGASR
A418F Ppp1r13bApoptosis-stimulating of p53 protein 1IMNGNLSAEIER
A418F Ppp1r13bApoptosis-stimulating of p53 protein 1NMEVAMmDKR
A418F Ppp1r13bApoptosis-stimulating of p53 protein 1LAnAPRPLK
A418F Ppp1r13bApoptosis-stimulating of p53 protein 1GPqTVNSSSIYSmYLqqATPPK
A418F Ppp1r13bApoptosis-stimulating of p53 protein 1IMNGNLSAEIER
A418F Ppp1r13bApoptosis-stimulating of p53 protein 1NMEVAMmDKR
A418F Ppp1r13bApoptosis-stimulating of p53 protein 1LAnAPRPLK
A418F Ppp1r13bApoptosis-stimulating of p53 protein 1GPqTVNSSSIYSmYLqqATPPK
A418F Ppp1r13bApoptosis-stimulating of p53 protein 1IMNGNLSAEIER
A4191 ParpbpPCNA-interacting partnercSQNDEQVR
A4191 ParpbpPCNA-interacting partnerSLqTEKNK
A4191 ParpbpPCNA-interacting partnerqLDLDSENLHcDR
A4191 ParpbpPCNA-interacting partnerILSAIKmqLIK
A4191 ParpbpPCNA-interacting partnerLNLPIENmK
A4204 IkProtein RedEEEELmEKPQK
A4204 IkProtein RedEEEELMEKPQK
A4212 PsapSulfated glycoprotein 1SLPcDIcK
A4212 PsapSulfated glycoprotein 1DVKTAVDcGAVK
A4212 PsapSulfated glycoprotein 1TcEWIHDSSLSAScK
A4212 PsapSulfated glycoprotein 1LVLYLEHNLEK
A4212 PsapSulfated glycoprotein 1LGPGVSDIcK
A4212 PsapSulfated glycoprotein 1TVVTEAGNLLK
A4212 PsapSulfated glycoprotein 1LVSDVQTAVK
A4212 PsapSulfated glycoprotein 1GcSFLPDPYQK
A4212 PsapSulfated glycoprotein 1SLPcDIcK
A4212 PsapSulfated glycoprotein 1DVKTAVDcGAVK
A4212 PsapSulfated glycoprotein 1TcEWIHDSSLSAScK
A4212 PsapSulfated glycoprotein 1LVLYLEHNLEK
A4212 PsapSulfated glycoprotein 1LGPGVSDIcK
A4212 PsapSulfated glycoprotein 1TVVTEAGNLLK
A4212 PsapSulfated glycoprotein 1LVSDVQTAVK
A4212 PsapSulfated glycoprotein 1MGGSGqTLVMPLTSPVQDPK
A4212 PsapSulfated glycoprotein 1GcSFLPDPYQK
A4219 Smc1bStructural maintenance of chromosomes protein 1BIqLMLFqLYYNEEK
A4219 Smc1bStructural maintenance of chromosomes protein 1BHVKqQqENDQK
A4219 Smc1bStructural maintenance of chromosomes protein 1BVGIMTQqLEKLQWEQK
A421G Fbxo43F-box only protein 43SKQEqYVK
A421G Fbxo43F-box only protein 43IKFnGnQTLDSSGEVR
A4233 Stag3Cohesin subunit SA-3VWTQQSLLLEcR
A423C Slc35a3UDP-N-acetylglucosamine transporterQPGSPGVAEPGAPVR
A423J Olfr867Olfactory receptor 867mLVNmqSqIK
A4248 Tmem70Transmembrane protein 70, mitochondrialMLLGLGGRWAAGLWPGR
A424A Fhl1Four and a half LIM domains protein 1FVFHNEQVYcPDcAK
A424A Fhl1Four and a half LIM domains protein 1FcANTcVDcR
A424A Fhl1Four and a half LIM domains protein 1FTAVEDQYYcVDcYK
A424A Fhl1Four and a half LIM domains protein 1nPITGFGK
A424A Fhl1Four and a half LIM domains protein 1GEDFYcVTcHETK
A424A Fhl1Four and a half LIM domains protein 1AITSGGITYQDQPWHAEcFVcVTcSK
A424A Fhl1Four and a half LIM domains protein 1AIVAGDQNVEYK
A424A Fhl1Four and a half LIM domains protein 1FVFHNEQVYcPDcAK
A424A Fhl1Four and a half LIM domains protein 1FcANTcVDcR
A424A Fhl1Four and a half LIM domains protein 1FTAVEDQYYcVDcYK
A424A Fhl1Four and a half LIM domains protein 1nPITGFGK
A424A Fhl1Four and a half LIM domains protein 1GEDFYcVTcHETK
A424A Fhl1Four and a half LIM domains protein 1AITSGGITYQDQPWHAEcFVcVTcSK
A424A Fhl1Four and a half LIM domains protein 1AIVAGDQNVEYK
A424A Fhl1Four and a half LIM domains protein 1FcANTcVDcR
A424A Fhl1Four and a half LIM domains protein 1FTAVEDQYYcVDcYK
A424A Fhl1Four and a half LIM domains protein 1GEDFYcVTcHETK
A424A Fhl1Four and a half LIM domains protein 1AIVAGDQNVEYK
A424A Fhl1Four and a half LIM domains protein 1FcANTcVDcR
A424A Fhl1Four and a half LIM domains protein 1FTAVEDQYYcVDcYK
A424A Fhl1Four and a half LIM domains protein 1cAGcKnPITGK
A424A Fhl1Four and a half LIM domains protein 1GEDFYcVTcHETK
A424A Fhl1Four and a half LIM domains protein 1AITSGGITYQDQPWHAEcFVcVTcSK
A424A Fhl1Four and a half LIM domains protein 1AIVAGDQNVEYK
A424A Fhl1Four and a half LIM domains protein 1FVFHNEQVYcPDcAK
A424A Fhl1Four and a half LIM domains protein 1FcANTcVDcR
A424A Fhl1Four and a half LIM domains protein 1FTAVEDQYYcVDcYK
A424A Fhl1Four and a half LIM domains protein 1GEDFYcVTcHETK
A424A Fhl1Four and a half LIM domains protein 1AITSGGITYQDQPWHAEcFVcVTcSK
A424A Fhl1Four and a half LIM domains protein 1AIVAGDQNVEYK
A424A Fhl1Four and a half LIM domains protein 1mASQRHSGPSSYK
A4259 Ubn2Ubinuclein-2LHLnVqDDR
A4259 Ubn2Ubinuclein-2LHLnVqDDR
A425A Fhl2Four and a half LIM domains protein 2QYALQcVQcK
A425A Fhl2Four and a half LIM domains protein 2ENQNFcVPcYEK
A425A Fhl2Four and a half LIM domains protein 2cAGcTNPISGLGGTK
A425E Ttc39cTetratricopeptide repeat protein 39CqELSAYIK
A425E Ttc39cTetratricopeptide repeat protein 39CAWKIYSK
A425E Ttc39cTetratricopeptide repeat protein 39CnnqIEQFSVK
A4260 Ufd1lUbiquitin fusion degradation protein 1 homologFQPqSPDFLDITnPK
A4260 Ufd1lUbiquitin fusion degradation protein 1 homologFQPqSPDFLDITnPK
A4267 Abce1ATP-binding cassette sub-family E member 1mGKLcIEVTPQSK
A4267 Abce1ATP-binding cassette sub-family E member 1NVEDLSGGELQR
A4268 Ahsa1Activator of 90 kDa heat shock protein ATPase homolog 1VFTTQELVQAFTHAPAALEADR
A426D Fam46cProtein FAM46CDIVqTVRGR
A4271 Atox1Copper transport protein ATOX1VcIDSEHSSDTLLATLNK
A4271 Atox1Copper transport protein ATOX1LGGVEFNIDLPNKK
A4271 Atox1Copper transport protein ATOX1AVSYLGPK
A4278 C1galt1c1C1GALT1-specific chaperone 1VFESINmDTNDmWLmMRK
A4278 C1galt1c1C1GALT1-specific chaperone 1ISEAERMELSK
A428A Fip1l1Pre-mRNA 3'-end-processing factor FIP1AEFTSPPSLFK
A428B Esyt1Extended synaptotagmin-1SnSSFmSR
A428B Esyt1Extended synaptotagmin-1RTLnPEFnER
A428E Ttc14Tetratricopeptide repeat protein 14VGRHVDAMnEYNK
A428E Ttc14Tetratricopeptide repeat protein 14VGRHVDAMnEYNK
A428E Ttc14Tetratricopeptide repeat protein 14VGRHVDAMnEYNK
A428G Fcrl6Fc receptor-like protein 6EPDSFLYVSVDnQRYK
A428I Sim1Single-minded homolog 1RNAGLTcGGYK
A428I Sim1Single-minded homolog 1EKENSEFYELAK
A428J Prl3c1Prolactin-3C1MqLSLTQAR
A4298 Dnajc17DnaJ homolog subfamily C member 17VKLDLEAR
A4298 Dnajc17DnaJ homolog subfamily C member 17VKLDLEAR
A429A Fmr1Fragile X mental retardation protein 1 homologTADGSLQSASSEGSR
A429A Fmr1Fragile X mental retardation protein 1 homologRAHMLIDMHFR
A429A Fmr1Fragile X mental retardation protein 1 homologRAHMLIDMHFR
A429A Fmr1Fragile X mental retardation protein 1 homologRAHMLIDMHFR
A429D Fam53bProtein FAM53BIALSLQPR
A4303 Dnaja4DnaJ homolog subfamily A member 4IIEVHVEK
A4308 Dnajb5DnaJ homolog subfamily B member 5RSLYDqYGEEGLK
A430E Ttc16Tetratricopeptide repeat domain 16qFLqNTLGAR
A430E Ttc16Tetratricopeptide repeat domain 16KATqVPKPK
A430E Ttc16Tetratricopeptide repeat domain 16qFLqNTLGAR
A430E Ttc16Tetratricopeptide repeat domain 16KATqVPKPK
A430E Ttc16Tetratricopeptide repeat domain 16qFLqNTLGAR
A431B Fam151aProtein FAM151AAVGPSLDLLR
A431E Ttc17Tetratricopeptide repeat protein 17KGPQDGVAK
A431E Ttc17Tetratricopeptide repeat protein 17RLDLqGIR
A431E Ttc17Tetratricopeptide repeat protein 17KGPQDGVAK
A431E Ttc17Tetratricopeptide repeat protein 17RLDLqGIR
A431E Ttc17Tetratricopeptide repeat protein 17KGPQDGVAK
A4320 Fkbp1bPeptidyl-prolyl cis-trans isomerase FKBP1BGQIcVVHYTGmLQNGK
A4320 Fkbp1bPeptidyl-prolyl cis-trans isomerase FKBP1BGFEEGTAqMSLGqRAK
A4320 Fkbp1bPeptidyl-prolyl cis-trans isomerase FKBP1BQEVIKGFEEGTAQmSLGQR
A4322 Fkbp2Peptidyl-prolyl cis-trans isomerase FKBP2LVIPSELGYGER
A4322 Fkbp2Peptidyl-prolyl cis-trans isomerase FKBP2GWDQGLLGMcEGEK
A432C Slc38a3Sodium-coupled neutral amino acid transporter 3qTEmVELVPnGK
A433A Foxj3Forkhead box protein J3KMTLSEI
A434K Zfp300Protein Zfp300TFnqKAHLnVHqR
A434K Zfp300Protein Zfp300LFEcnEcGKSFR
A4350 Hyou1Hypoxia up-regulated protein 1NATLAEQAK
A4350 Hyou1Hypoxia up-regulated protein 1LPATEKPVLLSK
A4350 Hyou1Hypoxia up-regulated protein 1LEELTLR
A4350 Hyou1Hypoxia up-regulated protein 1DAVIYPILVEFTR
A4350 Hyou1Hypoxia up-regulated protein 1FLGDSAAGMAIK
A4350 Hyou1Hypoxia up-regulated protein 1TLGGLEMELR
A4350 Hyou1Hypoxia up-regulated protein 1AAnSLEAFIFETQDK
A4350 Hyou1Hypoxia up-regulated protein 1VQEVLLK
A436G Ffar2Free fatty acid receptor 2FVWIMLTqPHVGAQR
A4370 PpibPeptidyl-prolyl cis-trans isomerase BVLEGMDVVR
A4370 PpibPeptidyl-prolyl cis-trans isomerase BDTNGSQFFITTVK
A4370 PpibPeptidyl-prolyl cis-trans isomerase BTSWLDGK
A4370 PpibPeptidyl-prolyl cis-trans isomerase BIEVEKPFAIAK
A4370 PpibPeptidyl-prolyl cis-trans isomerase BVIKDFMIQGGDFTR
A4370 PpibPeptidyl-prolyl cis-trans isomerase BDFMIQGGDFTR
A4370 PpibPeptidyl-prolyl cis-trans isomerase BIEVEKPFAIAKE
A4370 PpibPeptidyl-prolyl cis-trans isomerase BDKPLKDVIIVDSGK
A4370 PpibPeptidyl-prolyl cis-trans isomerase BFPDENFK
A4370 PpibPeptidyl-prolyl cis-trans isomerase BTVDNFVALATGEK
A4370 PpibPeptidyl-prolyl cis-trans isomerase BDTNGSqFFITTVK
A4371 PpicPeptidyl-prolyl cis-trans isomerase CTVENFVALATGEK
A4371 PpicPeptidyl-prolyl cis-trans isomerase CRGPSVTDK
A4371 PpicPeptidyl-prolyl cis-trans isomerase CTPFVVEVPDW
A4372 PpifPeptidyl-prolyl cis-trans isomerase F, mitochondrialTDWLDGK
A4372 PpifPeptidyl-prolyl cis-trans isomerase F, mitochondrialKIESFGSK
A4372 PpifPeptidyl-prolyl cis-trans isomerase F, mitochondrialVIPAFMcQAGDFTNHNGTGGR
A4372 PpifPeptidyl-prolyl cis-trans isomerase F, mitochondrialFPDENFTLK
A4372 PpifPeptidyl-prolyl cis-trans isomerase F, mitochondrialEGmDVVKK
A4372 PpifPeptidyl-prolyl cis-trans isomerase F, mitochondrialGANSSSGNPLVYLDVGADGQPLGR
A4375 Ppil2Peptidyl-prolyl cis-trans isomerase-like 2MSqPqPGNqGPqTYR
A4375 Ppil2Peptidyl-prolyl cis-trans isomerase-like 2AKqDPSYYLK
A4375 Ppil2Peptidyl-prolyl cis-trans isomerase-like 2qDIITLQDPTNLDK
A4375 Ppil2Peptidyl-prolyl cis-trans isomerase-like 2ETLqELYKEFK
A437A Foxn3Forkhead box protein N3LEEGAmEDEELTNLNWLHESKNLLK
A437A Foxn3Forkhead box protein N3LEEGAmEDEELTNLNWLHESKNLLK
A438E Ttc28Tetratricopeptide repeat protein 28NMVGMLHQVLVQLqAcEK
A438E Ttc28Tetratricopeptide repeat protein 28RqTSPQAR
A438E Ttc28Tetratricopeptide repeat protein 28qLNIARDmK
A438E Ttc28Tetratricopeptide repeat protein 28RDVLSLLnLSPR
A438E Ttc28Tetratricopeptide repeat protein 28ASSnLGIIHqMKGDYDTALK
A438E Ttc28Tetratricopeptide repeat protein 28cMQDLER
A438E Ttc28Tetratricopeptide repeat protein 28DINGAIKFYEQqLGLSHHVK
A438E Ttc28Tetratricopeptide repeat protein 28TVSYSSLGR
A438E Ttc28Tetratricopeptide repeat protein 28qYHEQqLGIAEDLK
A438E Ttc28Tetratricopeptide repeat protein 28VQAVHSLKmLWqSTPQPPR
A438H Mettl21AMethyltransferase-like protein 21AVALEFLKSnVEAnLPPHIQPK
A4390 Sec63Translocation protein SEC63 homologIPETLEEDQqFMLKK
A4390 Sec63Translocation protein SEC63 homologMKIPETLEEDQqFMLK
A4390 Sec63Translocation protein SEC63 homologIPETLEEDQqFMLKK
A4390 Sec63Translocation protein SEC63 homologMKIPETLEEDQqFMLK
A4392 TbcaTubulin-specific chaperone AMKAEDGEnYAIK
A4392 TbcaTubulin-specific chaperone AMMIPDcQR
A4392 TbcaTubulin-specific chaperone AQAEILQESR
A4396 AlyrefTHO complex subunit 4SLGTADVHFER
A4396 AlyrefTHO complex subunit 4SLGTADVHFER
A4399 Timm13Mitochondrial import inner membrane translocase subunit Tim13cIGKPGGSLDNSEQK
A4399 Timm13Mitochondrial import inner membrane translocase subunit Tim13cIAMcMDR
A4399 Timm13Mitochondrial import inner membrane translocase subunit Tim13YMDAWNTVSR
A4399 Timm13Mitochondrial import inner membrane translocase subunit Tim13VQIAVANAQELLQR
A4399 Timm13Mitochondrial import inner membrane translocase subunit Tim13LDPGAIMEQVK
A4402 Timm9Mitochondrial import inner membrane translocase subunit Tim9EFLGTYNK
A4402 Timm9Mitochondrial import inner membrane translocase subunit Tim9MAAQIPESDqIKqFK
A4402 Timm9Mitochondrial import inner membrane translocase subunit Tim9FQEYHIQQNEALAAK
A4402 Timm9Mitochondrial import inner membrane translocase subunit Tim9EVKPEEVTcSEHcLQK
A4428 Cacna1hVoltage-dependent T-type calcium channel subunit alpha-1HVSTGDnWNGImK
A4428 Cacna1hVoltage-dependent T-type calcium channel subunit alpha-1HSPPcSPRPASVRTR
A4428 Cacna1hVoltage-dependent T-type calcium channel subunit alpha-1HLYARWqSR
A4428 Cacna1hVoltage-dependent T-type calcium channel subunit alpha-1HTSFqVPSAASSPAR
A4428 Cacna1hVoltage-dependent T-type calcium channel subunit alpha-1HVSTGDnWNGImK
A4428 Cacna1hVoltage-dependent T-type calcium channel subunit alpha-1HSPPcSPRPASVRTR
A4428 Cacna1hVoltage-dependent T-type calcium channel subunit alpha-1HLYARWqSR
A4428 Cacna1hVoltage-dependent T-type calcium channel subunit alpha-1HTSFqVPSAASSPAR
A442H Mta1Metastasis-associated protein MTA1LcAScWTYWK
A4431 Cacnb1Voltage-dependent L-type calcium channel subunit beta-1qALAQLEK
A4431 Cacnb1Voltage-dependent L-type calcium channel subunit beta-1qALAQLEK
A443E Ttc38Tetratricopeptide repeat protein 38ELLTTLQEASK
A443E Ttc38Tetratricopeptide repeat protein 38NAGLPLSTTSNEAcK
A443E Ttc38Tetratricopeptide repeat protein 38DALKPNSPLTER
A443E Ttc38Tetratricopeptide repeat protein 38FSHDAYFYLGYQEQmR
A443E Ttc38Tetratricopeptide repeat protein 38VLELLLPIR
A443E Ttc38Tetratricopeptide repeat protein 38AAAVHLMQ
A443E Ttc38Tetratricopeptide repeat protein 38IVQIGGSNAQR
A443E Ttc38Tetratricopeptide repeat protein 38LFDATLTQYVK
A443H Mta3Metastasis-associated protein MTA3IEELNKTASGnVEAK
A4446 Clic4Chloride intracellular channel protein 4YLTNAYSR
A4446 Clic4Chloride intracellular channel protein 4EPLIELFVK
A4446 Clic4Chloride intracellular channel protein 4GMTGIWR
A4446 Clic4Chloride intracellular channel protein 4KPADLQNLAPGTHPPFITFNSEVK
A4446 Clic4Chloride intracellular channel protein 4DEFTNTcPSDKEVEIAYSDVAK
A4446 Clic4Chloride intracellular channel protein 4NSRPEANEALER
A4446 Clic4Chloride intracellular channel protein 4HPESNTAGMDIFAK
A4447 Clic5Chloride intracellular channel protein 5NYDIPAEMTGLWR
A4447 Clic5Chloride intracellular channel protein 5KLDDYLNSPLPEEIDTNTHGDEK
A4447 Clic5Chloride intracellular channel protein 5NYDIPAEMTGLWR
A4447 Clic5Chloride intracellular channel protein 5KLDDYLNSPLPEEIDTNTHGDEK
A4447 Clic5Chloride intracellular channel protein 5NYDIPAEMTGLWR
A4447 Clic5Chloride intracellular channel protein 5KLDDYLNSPLPEEIDTNTHGDEK
A444B Fam198bProtein FAM198BSEDnLNFKLLEGIR
A4465 Grik4Glutamate receptor, ionotropic kainate 4mLDDTRDPTPLLK
A446E Ttc9Tetratricopeptide repeat protein 9AYIqLTEMKLSR
A446E Ttc9Tetratricopeptide repeat protein 9ATRqPTDTnVIR
A4474 Kcnma1Calcium-activated potassium channel subunit alpha-1AHLLnIPSWnWK
A4474 Kcnma1Calcium-activated potassium channel subunit alpha-1AcHDDVTDPKR
A4474 Kcnma1Calcium-activated potassium channel subunit alpha-1AHLLnIPSWnWK
A4474 Kcnma1Calcium-activated potassium channel subunit alpha-1AHLLnIPSWnWK
A4474 Kcnma1Calcium-activated potassium channel subunit alpha-1AcHDDVTDPKR
A4474 Kcnma1Calcium-activated potassium channel subunit alpha-1KWFTDEPDnAYPR
A4474 Kcnma1Calcium-activated potassium channel subunit alpha-1AHLLnIPSWnWK
A4474 Kcnma1Calcium-activated potassium channel subunit alpha-1AcHDDVTDPKR
A4474 Kcnma1Calcium-activated potassium channel subunit alpha-1AHLLnIPSWnWK
A4474 Kcnma1Calcium-activated potassium channel subunit alpha-1AHLLnIPSWnWK
A4478 KCNH4Potassium voltage-gated channel subfamily H member 4TSFcAPGEYLLR
A4478 KCNH4Potassium voltage-gated channel subfamily H member 4QVmGLLqAR
A447H Mtfr1Mitochondrial fission regulator 1mWFQRVGVSmQSTR
A4481 Kcnh7Potassium voltage-gated channel subfamily H member 7LDLLQEqLnR
A4481 Kcnh7Potassium voltage-gated channel subfamily H member 7YHMQmLR
A4481 Kcnh7Potassium voltage-gated channel subfamily H member 7NQEGVAMmFIINFEYVTDEEnAATPERVNPILPVK
A4481 Kcnh7Potassium voltage-gated channel subfamily H member 7VEVTYYHKNGSTFIcNTHIIPVK
A4481 Kcnh7Potassium voltage-gated channel subfamily H member 7VEVTYYHKNGSTFIcNTHIIPVK
A4486 Kcnn1Small conductance calcium-activated potassium channel protein 1LVKKPDqGR
A4486 Kcnn1Small conductance calcium-activated potassium channel protein 1LVKKPDqGR
A4486 Kcnn1Small conductance calcium-activated potassium channel protein 1LVKKPDqGR
A448A Fyco1FYVE and coiled-coil domain-containing protein 1QqEKQHR
A448A Fyco1FYVE and coiled-coil domain-containing protein 1LEYLLQFDQKEK
A448A Fyco1FYVE and coiled-coil domain-containing protein 1TLVqqLK
A4491 Kcnq5Potassium voltage-gated channel subfamily KQT member 5SRSSqnIcK
A4491 Kcnq5Potassium voltage-gated channel subfamily KQT member 5ESVQFAQSNLTKDR
A4491 Kcnq5Potassium voltage-gated channel subfamily KQT member 5SRSSqnIcK
A4491 Kcnq5Potassium voltage-gated channel subfamily KQT member 5GSVFHSQKLSFK
A4491 Kcnq5Potassium voltage-gated channel subfamily KQT member 5ESVQFAQSNLTKDR
A4496 NalcnSodium leak channel non-selective proteinIFKLVPqMR
A449D Fastkd1FAST kinase domain-containing protein 1TELLFDTVNSSK
A4509 Ryr1Ryanodine receptor 1LmSLLEK
A4509 Ryr1Ryanodine receptor 1ISWSGSHLRWGqPLR
A4509 Ryr1Ryanodine receptor 1MDGTVDTPPcLR
A4509 Ryr1Ryanodine receptor 1cmDILELSERLDLQR
A4509 Ryr1Ryanodine receptor 1ISEDPARDGPGVR
A4509 Ryr1Ryanodine receptor 1LAEnIHELWALTR
A4509 Ryr1Ryanodine receptor 1SPPQEqINMLLHFK
A4509 Ryr1Ryanodine receptor 1LLYqQSR
A4509 Ryr1Ryanodine receptor 1IEIMGASR
A4509 Ryr1Ryanodine receptor 1LAqDSSQIELLK
A4509 Ryr1Ryanodine receptor 1mLDYLK
A4509 Ryr1Ryanodine receptor 1LGISILNGGnAEVQqKMLDYLK
A450A Gabpb2GA-binding protein subunit beta-2ELLqqqLQEAnRR
A450C Sec61a1Protein transport protein Sec61 subunit alpha isoform 1ETSMVHELNR
A450C Sec61a1Protein transport protein Sec61 subunit alpha isoform 1DVAKQLK
A450C Sec61a1Protein transport protein Sec61 subunit alpha isoform 1IIEVGDTPK
A450C Sec61a1Protein transport protein Sec61 subunit alpha isoform 1IIEVGDTPKDR
A450C Sec61a1Protein transport protein Sec61 subunit alpha isoform 1AFSPTTVNTGR
A450D Fastkd2FAST kinase domain-containing protein 2NHRLNVFDEGLqPSVR
A450D Fastkd2FAST kinase domain-containing protein 2LAqEcnSLSDVLDTFSK
A450D Fastkd2FAST kinase domain-containing protein 2NHRLNVFDEGLqPSVR
A450D Fastkd2FAST kinase domain-containing protein 2LAqEcnSLSDVLDTFSK
A450E Txndc16Thioredoxin domain-containing protein 16RWNTANWPK
A4510 Scn1aSodium channel protein type 1 subunit alphaKqqEAAQQAAATTASEHSR
A4510 Scn1aSodium channel protein type 1 subunit alphaFqGmVFDFVTR
A4510 Scn1aSodium channel protein type 1 subunit alphaRVLGESGEmDALR
A4510 Scn1aSodium channel protein type 1 subunit alphaTIKTMLEYADK
A451E Txndc5Thioredoxin domain-containing protein 5VDcTADSDVcSAQGVR
A451E Txndc5Thioredoxin domain-containing protein 5VDcTQHYAVcSEHQVR
A451E Txndc5Thioredoxin domain-containing protein 5ALAPTWEQLALGLEHSETVK
A4527 Tomm40Mitochondrial import receptor subunit TOM40 homologRPGEEGTVMSLAGK
A4527 Tomm40Mitochondrial import receptor subunit TOM40 homologMQDTSASFGYQLDLPK
A4531 Trpm1Transient receptor potential cation channel subfamily M member 1YLGPYVmmIGK
A4531 Trpm1Transient receptor potential cation channel subfamily M member 1LLISVHGGLQSFEmQPK
A4531 Trpm1Transient receptor potential cation channel subfamily M member 1GSLLDPqISR
A4531 Trpm1Transient receptor potential cation channel subfamily M member 1QSSINSADGYSLYR
A4531 Trpm1Transient receptor potential cation channel subfamily M member 1ELVTVFR
A4531 Trpm1Transient receptor potential cation channel subfamily M member 1YLGPYVmmIGK
A4531 Trpm1Transient receptor potential cation channel subfamily M member 1LLISVHGGLQSFEmQPK
A4531 Trpm1Transient receptor potential cation channel subfamily M member 1GSLLDPqISR
A4531 Trpm1Transient receptor potential cation channel subfamily M member 1QSSINSADGYSLYR
A4531 Trpm1Transient receptor potential cation channel subfamily M member 1ELVTVFR
A4544 AbraActin-binding Rho-activating proteinIKRPLLSQANR
A4544 AbraActin-binding Rho-activating proteinYSETLNcK
A4544 AbraActin-binding Rho-activating proteinGDEGYGRPK
A4544 AbraActin-binding Rho-activating proteinTATLVInLARGWQqWAnENSTK
A454G Fhdc1FH2 domain-containing protein 1SSQPFAAGGDSLPPK
A4559 ScinAdseverinAGQQAGLqVWRVEK
A4559 ScinAdseverinGDYQTSPLLETR
A4559 ScinAdseverinSLGGQAVQVR
A4559 ScinAdseverinASQVAIGIR
A4559 ScinAdseverinEGQAPAPPTR
A4559 ScinAdseverinMYLETDPSGR
A4561 Ahi1JouberinScAAKVnK
A4562 Aif1Allograft inflammatory factor 1LEGINKqFLDDPK
A4563 Aif1lAllograft inflammatory factor 1-likeYSDEENLPEK
A4563 Aif1lAllograft inflammatory factor 1-likeANESSPKPAGPPPER
A4563 Aif1lAllograft inflammatory factor 1-likeEFLcDQK
A4566 IgfalsInsulin-like growth factor-binding protein complex acid labile subunitFqALEEEAEMWLR
A4566 IgfalsInsulin-like growth factor-binding protein complex acid labile subunitANVFIHLPRLQK
A4573 Anxa11Annexin A11SELSGNFEK
A4573 Anxa11Annexin A11QRQQILLSFK
A4573 Anxa11Annexin A11EMSGDLEQGMLAVVK
A4573 Anxa11Annexin A11TPVLFDVYEIK
A4573 Anxa11Annexin A11DVQELYAAGENR
A4573 Anxa11Annexin A11GAGTDEAcLIEIFASR
A4573 Anxa11Annexin A11SELDLLDIR
A4573 Anxa11Annexin A11GFGTDEQAIIDcLGSR
A4573 Anxa11Annexin A11NTPAFFAER
A4575 Anxa4Annexin A4GLGTDDNTLIR
A4575 Anxa4Annexin A4WGTDEVK
A4575 Anxa4Annexin A4INQTYQQQYGR
A4575 Anxa4Annexin A4AEIDMLDIR
A4575 Anxa4Annexin A4INQTYQQQYGR
A4575 Anxa4Annexin A4GLGTDDNTLIR
A4575 Anxa4Annexin A4WGTDEVK
A4575 Anxa4Annexin A4INQTYQQQYGR
A457C Slc6a17Sodium-dependent neutral amino acid transporter SLC6A17ANImnEKcVVENAEK
A4580 Apc2Adenomatous polyposis coli protein 2EVGSMTALMEcVLR
A4580 Apc2Adenomatous polyposis coli protein 2ATIRLLEELDqER
A4580 Apc2Adenomatous polyposis coli protein 2SDIRPTEITQK
A4580 Apc2Adenomatous polyposis coli protein 2MmAGESTMLR
A4580 Apc2Adenomatous polyposis coli protein 2GISGPcTTPKK
A4580 Apc2Adenomatous polyposis coli protein 2QKPTGRAAPAR
A4582 Arl3ADP-ribosylation factor-like protein 3LnVWDIGGQRK
A4582 Arl3ADP-ribosylation factor-like protein 3ILLLGLDNAGK
A4584 Arl8bADP-ribosylation factor-like protein 8BMNLSAIQDR
A4584 Arl8bADP-ribosylation factor-like protein 8BEIccYSIScK
A4584 Arl8bADP-ribosylation factor-like protein 8BGVNAIVYMIDAADREK
A4584 Arl8bADP-ribosylation factor-like protein 8BEKDNIDITLQWLIQHSK
A4584 Arl8bADP-ribosylation factor-like protein 8BDLPNALDEK
A4589 AvilAdvillinRLqQETLDVqVR
A4589 AvilAdvillinKGGVASGMK
A4589 AvilAdvillinnELGDATAIVR
A458E Ube4bUbiquitin conjugation factor E4 BDLIGQILmEVLMMSTQTR
A458E Ube4bUbiquitin conjugation factor E4 BIHEVQEEMK
A458E Ube4bUbiquitin conjugation factor E4 BEQIqAWMR
A458E Ube4bUbiquitin conjugation factor E4 BAPKMcSqPAVSqLLSNIR
A458E Ube4bUbiquitin conjugation factor E4 BILDPAYPDVTLPLNSEVPK
A458E Ube4bUbiquitin conjugation factor E4 BDQqQARQSQLAQDER
A458E Ube4bUbiquitin conjugation factor E4 BDLIGQILmEVLMMSTQTR
A458E Ube4bUbiquitin conjugation factor E4 BILDPAYPDVTLPLNSEVPK
A458E Ube4bUbiquitin conjugation factor E4 BDQqQARQSQLAQDER
A4592 BcamBasal cell adhesion moleculeGEQVALDcTPR
A4592 BcamBasal cell adhesion moleculeAGAAGTSEATSSVR
A4592 BcamBasal cell adhesion moleculeTQSFQLIVQGAPELKPNEIMPK
A4592 BcamBasal cell adhesion moleculeEGVScEASNIHGK
A4592 BcamBasal cell adhesion moleculeVFATPEDTEVSPNK
A4592 BcamBasal cell adhesion moleculeGDTPAEPPFEGR
A4592 BcamBasal cell adhesion moleculeLASVEPQGSEFLGTVHSLGR
A4592 BcamBasal cell adhesion moleculeLEVPMEVNQK
A4592 BcamBasal cell adhesion moleculeGEQVALDcTPR
A4592 BcamBasal cell adhesion moleculeNGQRLEVPmEVnQ
A4592 BcamBasal cell adhesion moleculeAGAAGTSEATSSVR
A4592 BcamBasal cell adhesion moleculeVFATPEDTEVSPNK
A4592 BcamBasal cell adhesion moleculeLASVEPQGSEFLGTVHSLGR
A4593 Bfsp1FilensinARDLTAEHAR
A4593 Bfsp1FilensinARDLTAEHAR
A4596 Baiap2l1Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1NALKYEHK
A460A Golga5Golgin subfamily A member 5NQLTnKTLSnSSQSELESR
A460A Golga5Golgin subfamily A member 5VDqGAATALR
A460A Golga5Golgin subfamily A member 5MKqEFR
A460A Golga5Golgin subfamily A member 5ETQEELNK
A460H Mybl1Myb-related protein AVLITTPLqK
A460H Mybl1Myb-related protein AQDInSAnKTYTLNK
A460H Mybl1Myb-related protein AqDINSAnKTYTLnK
A460H Mybl1Myb-related protein AVLITTPLqK
A461E Usp54Inactive ubiquitin carboxyl-terminal hydrolase 54mQNTSTRDVIGSQDR
A461E Usp54Inactive ubiquitin carboxyl-terminal hydrolase 54GWETESTSSEAK
A461E Usp54Inactive ubiquitin carboxyl-terminal hydrolase 54qGLPKATGR
A461I Slitrk2SLIT and NTRK-like protein 2SLPDnIFGGTALTR
A4620 Cdh20Cadherin-20TGVIRTALMnmDR
A4620 Cdh20Cadherin-20TGVIRTALMnMDR
A462B Fer1l4Fer-1-like protein 4LNnMQR
A462B Fer1l4Fer-1-like protein 4VcKAQDFQVGVTVLEAQK
A462B Fer1l4Fer-1-like protein 4VcKAqDFqVGVTVLEAqK
A4630 CcinCalicinVVISEqnVEELLR
A4630 CcinCalicinYVSnIYRYDER
A4630 CcinCalicinSLISSNDMK
A4633 Cap1Adenylyl cyclase-associated protein 1cVNTTLQIK
A4633 Cap1Adenylyl cyclase-associated protein 1INSITVDNcK
A4633 Cap1Adenylyl cyclase-associated protein 1KEPALLELEGK
A4633 Cap1Adenylyl cyclase-associated protein 1TDGcHAYLSK
A4633 Cap1Adenylyl cyclase-associated protein 1ALLATASQcQQPAGNK
A4633 Cap1Adenylyl cyclase-associated protein 1SALFAQINQGESITHALK
A4633 Cap1Adenylyl cyclase-associated protein 1EMNDAAMFYTNR
A4633 Cap1Adenylyl cyclase-associated protein 1LEAVSHTSDMHcGYGDSPSK
A4633 Cap1Adenylyl cyclase-associated protein 1NSLDcEIVSAK
A4637 Ccbe1Collagen and calcium-binding EGF domain-containing protein 1GAPGPPGSPGPPGSFDFLLLVLADIR
A4638 Ccdc80Coiled-coil domain-containing protein 80TqVHPTREAPR
A4638 Ccdc80Coiled-coil domain-containing protein 80TLQVEER
A4638 Ccdc80Coiled-coil domain-containing protein 80qSLENFLSR
A4644 Cd2apCD2-associated proteinEGEIIHLISK
A4644 Cd2apCD2-associated proteinAqIIELLcIVDALK
A4645 Cd33Myeloid cell surface antigen CD33LSVHMGcEnPIKR
A464B Fras1Extracellular matrix protein FRAS1ADnLEQISVRGPIR
A464B Fras1Extracellular matrix protein FRAS1SPqHGMLVK
A464B Fras1Extracellular matrix protein FRAS1SAMGSSLYALESGSDFK
A464B Fras1Extracellular matrix protein FRAS1NAnRQYcTVR
A4651 Cdhr5Cadherin-related family member 5ASEPQPSGYDNLTFLPDHK
A4651 Cdhr5Cadherin-related family member 5ASEPQPSGYDNLTFLPDHK
A4656 Cep120Centrosomal protein of 120 kDaQqWGRALK
A4656 Cep120Centrosomal protein of 120 kDaIqLSNILSSEK
A4656 Cep120Centrosomal protein of 120 kDaWYQLLSNK
A4656 Cep120Centrosomal protein of 120 kDaDGKVLASLAGVDPK
A4656 Cep120Centrosomal protein of 120 kDaAALELEMWKEmQEDIFESQLK
A4656 Cep120Centrosomal protein of 120 kDaQqWGRALK
A4656 Cep120Centrosomal protein of 120 kDaIqLSNILSSEK
A4656 Cep120Centrosomal protein of 120 kDaWYQLLSNK
A4656 Cep120Centrosomal protein of 120 kDaDGKVLASLAGVDPK
A4656 Cep120Centrosomal protein of 120 kDaAALELEMWKEmQEDIFESQLK
A4663 Ceacam1Carcinoembryonic antigen-related cell adhesion molecule 1LSEGnRTLTLLnVTR
A4668 CenpjCentromere protein JETESSLDFSLqKK
A4668 CenpjCentromere protein JKEITFPDQTIK
A4668 CenpjCentromere protein JKTALINK
A4668 CenpjCentromere protein JVTELESEIEKFK
A4668 CenpjCentromere protein JEPLQqVnFPDLEYK
A4668 CenpjCentromere protein JILERDQqIcDGHR
A4668 CenpjCentromere protein JGQSNcSEIPR
A466D Flg2Filaggrin-2TRGnHETGK
A466D Flg2Filaggrin-2YSGYGHGqGqAGHqqR
A4671 Cep68Centrosomal protein of 68 kDaGKSSLmSnqTLGVSSKPLK
A4671 Cep68Centrosomal protein of 68 kDaMGSPqLKTK
A4671 Cep68Centrosomal protein of 68 kDaIAKqSGELESR
A4671 Cep68Centrosomal protein of 68 kDaTQPASKAmTDR
A4671 Cep68Centrosomal protein of 68 kDaGKSSLmSnqTLGVSSKPLK
A4671 Cep68Centrosomal protein of 68 kDaMGSPqLKTK
A4671 Cep68Centrosomal protein of 68 kDaTQPASKAmTDR
A4673 Cep85Centrosomal protein of 85 kDaAHFPnPRPDTnK
A4674 Cep89Centrosomal protein of 89 kDaLLIEQLEIqqAK
A4674 Cep89Centrosomal protein of 89 kDaSLLqATLERR
A4674 Cep89Centrosomal protein of 89 kDaLTALqVqKK
A4674 Cep89Centrosomal protein of 89 kDaLLIEQLEIqqAK
A4674 Cep89Centrosomal protein of 89 kDaLTALqVqKK
A4674 Cep89Centrosomal protein of 89 kDaSLLqATLERR
A467G Fli1Friend leukemia integration 1 transcription factorINPLPPQQEWInqPVRVnVK
A4680 Ckap2Cytoskeleton-associated protein 2AQmTEWRTGK
A4680 Ckap2Cytoskeleton-associated protein 2VnLGENIEEAHATK
A4680 Ckap2Cytoskeleton-associated protein 2QENQISRDQK
A4680 Ckap2Cytoskeleton-associated protein 2AQSEPANTVSVKASTTAAATK
A4680 Ckap2Cytoskeleton-associated protein 2TISEcLNLINEGcPK
A4686 Cnn2Calponin-2YDPqKEAELR
A4686 Cnn2Calponin-2cASQVGMTAPGTR
A4686 Cnn2Calponin-2cASQSGMTAYGTR
A4686 Cnn2Calponin-2YDPQKEAELR
A4686 Cnn2Calponin-2LqPGSVPK
A4686 Cnn2Calponin-2GPSYGLSAEVK
A4686 Cnn2Calponin-2YDPqKEAELR
A4686 Cnn2Calponin-2cASQVGMTAPGTR
A4686 Cnn2Calponin-2cASQSGMTAYGTR
A4686 Cnn2Calponin-2YDPQKEAELR
A4686 Cnn2Calponin-2LqPGSVPK
A4686 Cnn2Calponin-2GPSYGLSAEVK
A4687 Cnn3Calponin-3GASQAGMLAPGTR
A4687 Cnn3Calponin-3cASQAGMTAYGTR
A4687 Cnn3Calponin-3GMSVYGLGR
A4687 Cnn3Calponin-3cASQAGmTAYGTR
A4687 Cnn3Calponin-3GPSYGLSAEVK
A4687 Cnn3Calponin-3DGIILcELINK
A4688 CntlnCentleinLnVAVKEK
A4688 CntlnCentleinEKSqYEqMYqK
A4688 CntlnCentleinDLKmSVLISK
A4688 CntlnCentleinEKELEQLLR
A4688 CntlnCentleinQHEDAEVKK
A4688 CntlnCentleinVIELENRLK
A4688 CntlnCentleinVIELENR
A4688 CntlnCentleinQSVVNLQGqLFqKEQEnVK
A4689 Cntn3Contactin-3LQFAYLEnFK
A4689 Cntn3Contactin-3LVSqETGHLYIAK
A468B Gimap1GTPase IMAP family member 1EAQAEQLLGMVAcLVR
A468C Sec22bVesicle-trafficking protein SEC22bIMVAnIEEVLQR
A468C Sec22bVesicle-trafficking protein SEC22bNLGSINTELQDVQR
A468C Sec22bVesicle-trafficking protein SEC22bDLQQYQSQAK
A468C Sec22bVesicle-trafficking protein SEC22bIMVANIEEVLQR
A468C Sec22bVesicle-trafficking protein SEC22bIMVAnIEEVLQR
A468C Sec22bVesicle-trafficking protein SEC22bDLQQYQSQAK
A468C Sec22bVesicle-trafficking protein SEC22bIMVANIEEVLQR
A4697 Col6a4Collagen alpha-4(VI) chainGRqGPPGFFGqK
A4697 Col6a4Collagen alpha-4(VI) chainGEPGHPGPQGPRGR
A4697 Col6a4Collagen alpha-4(VI) chainGEPGFPGYPGVQGEDGNPGR
A4697 Col6a4Collagen alpha-4(VI) chainnILLSLLmK
A4697 Col6a4Collagen alpha-4(VI) chainDFEKmK
A4697 Col6a4Collagen alpha-4(VI) chainSqRIVcR
A4697 Col6a4Collagen alpha-4(VI) chainMKDFMER
A4698 Col6a5Collagen alpha-5(VI) chainnEIVHRIcSEK
A4698 Col6a5Collagen alpha-5(VI) chainGRSGLQGSqGPPGR
A4698 Col6a5Collagen alpha-5(VI) chainRVAVFFSnGqAASR
A4698 Col6a5Collagen alpha-5(VI) chainVnFGQNFDSLK
A4698 Col6a5Collagen alpha-5(VI) chainIQIGADRSQVGVVQFSDYnR
A4698 Col6a5Collagen alpha-5(VI) chainQGQPLFqGHPR
A4698 Col6a5Collagen alpha-5(VI) chainnEIVHRIcSEK
A4698 Col6a5Collagen alpha-5(VI) chainRVAVFFSnGqAASR
A4698 Col6a5Collagen alpha-5(VI) chainVnFGQNFDSLK
A4698 Col6a5Collagen alpha-5(VI) chainIQIGADRSQVGVVQFSDYnR
A4698 Col6a5Collagen alpha-5(VI) chainQGQPLFqGHPR
A469C Sec23bProtein transport protein Sec23BHIEAAFDQEAAAVLMAR
A4702 Col9a1Collagen alpha-1(IX) chainGEIGEPGRqGHK
A4709 Col14a1Collagen alpha-1(XIV) chainLLVAPASGGK
A4709 Col14a1Collagen alpha-1(XIV) chainGnGSKPTSPEEVK
A4709 Col14a1Collagen alpha-1(XIV) chainISnVGSnSARLTWDPASGK
A4709 Col14a1Collagen alpha-1(XIV) chainSFMVNWTQSPGK
A4709 Col14a1Collagen alpha-1(XIV) chainFNFRLVR
A4709 Col14a1Collagen alpha-1(XIV) chainDTLFTSDSGTR
A4709 Col14a1Collagen alpha-1(XIV) chainTLPSSGPqnLR
A4709 Col14a1Collagen alpha-1(XIV) chainnLRISNVGSnSAR
A4709 Col14a1Collagen alpha-1(XIV) chainLLVAPASGGK
A4709 Col14a1Collagen alpha-1(XIV) chainGnGSKPTSPEEVK
A4709 Col14a1Collagen alpha-1(XIV) chainSFMVNWTQSPGK
A4709 Col14a1Collagen alpha-1(XIV) chainFNFRLVR
A4709 Col14a1Collagen alpha-1(XIV) chainDTLFTSDSGTR
A4709 Col14a1Collagen alpha-1(XIV) chainTLPSSGPqnLR
A4709 Col14a1Collagen alpha-1(XIV) chainnLRISNVGSnSAR
A4721 Col24a1Collagen alpha-1(XXIV) chainVnnAFLFSIR
A4721 Col24a1Collagen alpha-1(XXIV) chainASSGFAHTnQDTMKnLEK
A4724 Col28a1Collagen alpha-1(XXVIII) chainSLnLIGqGTFSYYAISNATRLLK
A4724 Col28a1Collagen alpha-1(XXVIII) chainFHSEKEcR
A4724 Col28a1Collagen alpha-1(XXVIII) chainGIqGIGGPPGDPGPKGFqGnK
A4724 Col28a1Collagen alpha-1(XXVIII) chainTPnPnLLqSEKSLYK
A4727 Cep135Centrosomal protein of 135 kDaYITEVSR
A4727 Cep135Centrosomal protein of 135 kDaNLcEmRNLEEK
A4727 Cep135Centrosomal protein of 135 kDaRLqDDLATMAR
A4727 Cep135Centrosomal protein of 135 kDaLTTQSRETSmLR
A4727 Cep135Centrosomal protein of 135 kDaETVTTEVVNLSNRNEK
A4727 Cep135Centrosomal protein of 135 kDaHIqELmETK
A4727 Cep135Centrosomal protein of 135 kDaKYInIR
A4727 Cep135Centrosomal protein of 135 kDaLLTAERDK
A4727 Cep135Centrosomal protein of 135 kDaSDLETVVHQLEqEK
A4727 Cep135Centrosomal protein of 135 kDaTEKIANLqESLLSK
A4727 Cep135Centrosomal protein of 135 kDaIQqLQEKnLR
A473A Hist1h1bHistone H1.5KAASGEAKPK
A473A Hist1h1bHistone H1.5KALAAGGYDVEK
A473A Hist1h1bHistone H1.5ATGPPVSELITK
A473A Hist1h1bHistone H1.5GTGASGSFK
A473A Hist1h1bHistone H1.5KPAGATPK
A473A Hist1h1bHistone H1.5ALAAGGYDVEK
A473F Bbs4Bardet-Biedl syndrome 4 protein homologTQVPASVESqKPR
A473F Bbs4Bardet-Biedl syndrome 4 protein homologIHLLQGDLDK
A473F Bbs4Bardet-Biedl syndrome 4 protein homologMAEVKLGMK
A4745 DbnlDrebrin-like proteinAMSTTSVTSSQPGK
A4745 DbnlDrebrin-like proteinQLTQPETSYGR
A4745 DbnlDrebrin-like proteinTNAISEIKR
A4748 Epb49Dematin 48 kDa subunitQRESVGGSPQSK
A4748 Epb49Dematin 48 kDa subunitSSSLPSYGR
A4748 Epb49Dematin 48 kDa subunitMDnQVLGYK
A4748 Epb49Dematin 48 kDa subunitMDNQVLGYK
A4748 Epb49Dematin 48 kDa subunitQRESVGGSPQSK
A4748 Epb49Dematin 48 kDa subunitSSSLPSYGR
A4748 Epb49Dematin 48 kDa subunitMDnQVLGYK
A4748 Epb49Dematin 48 kDa subunitMDNQVLGYK
A474C Slc5a1Sodium/glucose cotransporter 1IAcVLPEEcQK
A474C Slc5a1Sodium/glucose cotransporter 1LLPMFLMVMPGMISR
A474C Slc5a1Sodium/glucose cotransporter 1MITEFAYGTGScMEPSncPK
A474C Slc5a1Sodium/glucose cotransporter 1IAcVLPEEcQK
A474C Slc5a1Sodium/glucose cotransporter 1LLPMFLMVMPGMISR
A474C Slc5a1Sodium/glucose cotransporter 1MITEFAYGTGScMEPSncPK
A474C Slc5a1Sodium/glucose cotransporter 1IAcVLPEEcQK
A474C Slc5a1Sodium/glucose cotransporter 1LLPMFLMVMPGMISR
A4755 Dsg1bDesmoglein-1-betaGTVLSIDDSLQR
A4757 Dsg3Desmoglein-3TNEGILK
A4758 Dsg4Desmoglein-4TNEGILK
A4758 Dsg4Desmoglein-4TNEGILK
A475G Fnip2Folliculin-interacting protein 2qqGGLLIAADVPYGDASGK
A475G Fnip2Folliculin-interacting protein 2VQFYVSRLmEALGEFR
A4762 Dnah12Dynein heavy chain 12, axonemalIIncNVK
A4762 Dnah12Dynein heavy chain 12, axonemalLmnHLEK
A4762 Dnah12Dynein heavy chain 12, axonemalQSGGnALLIGLGGSGR
A4762 Dnah12Dynein heavy chain 12, axonemalGcLLIEK
A4762 Dnah12Dynein heavy chain 12, axonemalFnNLIR
A4762 Dnah12Dynein heavy chain 12, axonemalGLnAYLEKK
A4762 Dnah12Dynein heavy chain 12, axonemalELqYqLnDIVELVRGK
A4764 Dnah17Dynein heavy chain 17, axonemalVVQLEELLqVR
A4764 Dnah17Dynein heavy chain 17, axonemalqSLSRLAAYISALDVFqITLK
A4764 Dnah17Dynein heavy chain 17, axonemalEKAIADEEEmK
A4764 Dnah17Dynein heavy chain 17, axonemalnMITSLRAVSELqnPAIR
A4764 Dnah17Dynein heavy chain 17, axonemalKcqQFELK
A4764 Dnah17Dynein heavy chain 17, axonemalQALEEANAELAEAqEK
A4764 Dnah17Dynein heavy chain 17, axonemalDLANLTHEGPK
A4764 Dnah17Dynein heavy chain 17, axonemalVqTIEDLYK
A4764 Dnah17Dynein heavy chain 17, axonemalEnYRPAAER
A4764 Dnah17Dynein heavy chain 17, axonemalAVSELqnPAIR
A4764 Dnah17Dynein heavy chain 17, axonemalVEFSKWWINEFK
A4764 Dnah17Dynein heavy chain 17, axonemalnKIAELNANLSNLTSAFEK
A4764 Dnah17Dynein heavy chain 17, axonemalLEEGYENAIKDYnK
A4764 Dnah17Dynein heavy chain 17, axonemalMPDLRIDYLETVSSVLLK
A4764 Dnah17Dynein heavy chain 17, axonemalVEFEFWDARLMnLQcIHEqLNRPK
A4764 Dnah17Dynein heavy chain 17, axonemalVVQLEELLqVR
A4764 Dnah17Dynein heavy chain 17, axonemalqSLSRLAAYISALDVFqITLK
A4764 Dnah17Dynein heavy chain 17, axonemalEKAIADEEEmK
A4764 Dnah17Dynein heavy chain 17, axonemalnMITSLRAVSELqnPAIR
A4764 Dnah17Dynein heavy chain 17, axonemalKcqQFELK
A4764 Dnah17Dynein heavy chain 17, axonemalQALEEANAELAEAqEK
A4764 Dnah17Dynein heavy chain 17, axonemalDLANLTHEGPK
A4764 Dnah17Dynein heavy chain 17, axonemalVqTIEDLYK
A4764 Dnah17Dynein heavy chain 17, axonemalEnYRPAAER
A4764 Dnah17Dynein heavy chain 17, axonemalAVSELqnPAIR
A4764 Dnah17Dynein heavy chain 17, axonemalVEFSKWWINEFK
A4764 Dnah17Dynein heavy chain 17, axonemalnKIAELNANLSNLTSAFEK
A4764 Dnah17Dynein heavy chain 17, axonemalLEEGYENAIKDYnK
A4764 Dnah17Dynein heavy chain 17, axonemalLGFTIDnGK
A4764 Dnah17Dynein heavy chain 17, axonemalMPDLRIDYLETVSSVLLK
A4764 Dnah17Dynein heavy chain 17, axonemalVEFEFWDARLMnLQcIHEqLNRPK
A4765 Dnah2Dynein heavy chain 2, axonemalVIGqPRGnmLLVGIGGSGR
A4765 Dnah2Dynein heavy chain 2, axonemalQGPLPcFFGAqGPqITR
A4765 Dnah2Dynein heavy chain 2, axonemalVGGqSREEK
A4765 Dnah2Dynein heavy chain 2, axonemalAqEmSELLLVHITGK
A4765 Dnah2Dynein heavy chain 2, axonemalcQALADNAqK
A4765 Dnah2Dynein heavy chain 2, axonemalIFGTMINQK
A4765 Dnah2Dynein heavy chain 2, axonemalEADEqQKAVTANSEK
A4765 Dnah2Dynein heavy chain 2, axonemalQLGEqnFIKSLInFDK
A4765 Dnah2Dynein heavy chain 2, axonemalLEmLKK
A4765 Dnah2Dynein heavy chain 2, axonemalmGcFqTLQTEAMESmAHGLFRR
A4767 Dnah5Dynein heavy chain 5, axonemalQFSDILDQISR
A4767 Dnah5Dynein heavy chain 5, axonemalSPQEAEILR
A4767 Dnah5Dynein heavy chain 5, axonemalDKAIAEEK
A4767 Dnah5Dynein heavy chain 5, axonemalIMDcVLLLFqRR
A4767 Dnah5Dynein heavy chain 5, axonemalQFSDILDqISR
A4767 Dnah5Dynein heavy chain 5, axonemalEVITSmDR
A4767 Dnah5Dynein heavy chain 5, axonemalLPNPAYTPEISAR
A4767 Dnah5Dynein heavy chain 5, axonemalVFVTEGK
A4767 Dnah5Dynein heavy chain 5, axonemalTLTLAnGDR
A4767 Dnah5Dynein heavy chain 5, axonemalYnmPFKAqIqK
A4767 Dnah5Dynein heavy chain 5, axonemalLKqFSDILDQISR
A4767 Dnah5Dynein heavy chain 5, axonemalnLnFSSATTPVmFqR
A4767 Dnah5Dynein heavy chain 5, axonemalYqIIFQNFATDIDTISKLYTK
A4767 Dnah5Dynein heavy chain 5, axonemalFSNIDKSWVK
A4767 Dnah5Dynein heavy chain 5, axonemalTNQAFLELLNMLIEITTK
A4767 Dnah5Dynein heavy chain 5, axonemalAITAPQmFGR
A476D Fxr2Fragile X mental retardation syndrome-related protein 2nLVGNVIGK
A476D Fxr2Fragile X mental retardation syndrome-related protein 2VIQEIVDK
A476J Tas2r136Taste receptor type 2 member 136IKqAFVLAmVqVR
A4770 Dnahc8Dynein heavy chain 8, axonemalnImEAPLLKNK
A4770 Dnahc8Dynein heavy chain 8, axonemalHVVETmGLFHDMVSEScENYFqR
A4770 Dnahc8Dynein heavy chain 8, axonemalLTESTPK
A4770 Dnahc8Dynein heavy chain 8, axonemalTNFLIDTIAKQHK
A4770 Dnahc8Dynein heavy chain 8, axonemalGSDQPPASGKPLK
A4770 Dnahc8Dynein heavy chain 8, axonemalVqMSSLHnIIR
A4770 Dnahc8Dynein heavy chain 8, axonemalGVALLcDIK
A4770 Dnahc8Dynein heavy chain 8, axonemalLPqFAEImnqISR
A4770 Dnahc8Dynein heavy chain 8, axonemalLSqDLAVK
A4770 Dnahc8Dynein heavy chain 8, axonemalTSVIDFTVTMK
A4770 Dnahc8Dynein heavy chain 8, axonemalKIMqITnQK
A4770 Dnahc8Dynein heavy chain 8, axonemalLSLDTMKR
A4770 Dnahc8Dynein heavy chain 8, axonemalTVAmmVPDRqIIMR
A4770 Dnahc8Dynein heavy chain 8, axonemalAITAPQmFGR
A4770 Dnahc8Dynein heavy chain 8, axonemalnImEAPLLKNK
A4770 Dnahc8Dynein heavy chain 8, axonemalGSDQPPASGKPLK
A4770 Dnahc8Dynein heavy chain 8, axonemalLPqFAEImnqISR
A4770 Dnahc8Dynein heavy chain 8, axonemalLSqDLAVK
A4770 Dnahc8Dynein heavy chain 8, axonemalTSVIDFTVTMK
A4770 Dnahc8Dynein heavy chain 8, axonemalTLTLAnGDR
A4770 Dnahc8Dynein heavy chain 8, axonemalKIMqITnQK
A4770 Dnahc8Dynein heavy chain 8, axonemalLSLDTMKR
A4770 Dnahc8Dynein heavy chain 8, axonemalTVAmmVPDRqIIMR
A4770 Dnahc8Dynein heavy chain 8, axonemalAITAPQmFGR
A4775 Ecm2Extracellular matrix protein 2SIPPGIqDMK
A477C Slc5a8Sodium-coupled monocarboxylate transporter 1LHPVEVGGTDNPAFNHVELNFTDHSGK
A477C Slc5a8Sodium-coupled monocarboxylate transporter 1ILSDAFNGGR
A477C Slc5a8Sodium-coupled monocarboxylate transporter 1QNLDPRFLLTK
A477C Slc5a8Sodium-coupled monocarboxylate transporter 1QDFLSNFDVFK
A477F Bcar3Breast cancer anti-estrogen resistance protein 3RPISqqSGAIIFqPInR
A477F Bcar3Breast cancer anti-estrogen resistance protein 3RPISqqSGAIIFQPINR
A477F Bcar3Breast cancer anti-estrogen resistance protein 3MAAGKFASLPR
A477F Bcar3Breast cancer anti-estrogen resistance protein 3RPISqqSGAIIFqPInR
A477F Bcar3Breast cancer anti-estrogen resistance protein 3RPISqqSGAIIFQPINR
A4782 Eml6Echinoderm microtubule-associated protein-like 6HTIRPSEAEK
A4782 Eml6Echinoderm microtubule-associated protein-like 6mVScGVKHIK
A4782 Eml6Echinoderm microtubule-associated protein-like 6EHFLIR
A4782 Eml6Echinoderm microtubule-associated protein-like 6ccAFSPDGK
A4782 Eml6Echinoderm microtubule-associated protein-like 6YLqTNDGAGERLFYK
A478F Bcas3Breast carcinoma-amplified sequence 3 homologNSTPERPmAVKcLELqR
A478J Tas2r143Taste receptor type 2 member 143MRGHRPGPWDLHTQAHTmALK
A4791 EpcamEpithelial cell adhesion moleculeIKPEGAIQNNDGLYDPDcDEQGLFK
A4791 EpcamEpithelial cell adhesion moleculeESPYDHQSLQTALQEAFTSR
A4797 Fam65bProtein FAM65BESLSEINR
A4797 Fam65bProtein FAM65BESLSEINR
A4798 Fam83hProtein FAM83HAVVSqAWR
A4798 Fam83hProtein FAM83HcSAIFRSDSLGTqGR
A4798 Fam83hProtein FAM83HSDSLGTQGRLSR
A4798 Fam83hProtein FAM83HqDSFRSR
A4799 Fat1Cadherin FAT1 isoform +12 (Fragment)VVDLDPcLSK
A4799 Fat1Cadherin FAT1 isoform +12 (Fragment)FRLDPATGALYTAEK
A4799 Fat1Cadherin FAT1 isoform +12 (Fragment)TLALLDR
A4799 Fat1Cadherin FAT1 isoform +12 (Fragment)GGNTAILNR
A4799 Fat1Cadherin FAT1 isoform +12 (Fragment)VVHIISPqFR
A4799 Fat1Cadherin FAT1 isoform +12 (Fragment)YELTVRASDGR
A4799 Fat1Cadherin FAT1 isoform +12 (Fragment)FnLNqYLPnFYPADMSEPQK
A479C Slc5a10Sodium/glucose cotransporter 5VLFPDDVGcVVPSEcLR
A479C Slc5a10Sodium/glucose cotransporter 5AcGAEIGcSNIAYPK
A479C Slc5a10Sodium/glucose cotransporter 5VLFPDDVGcVVPSEcLR
A479C Slc5a10Sodium/glucose cotransporter 5AcGAEIGcSNIAYPK
A479I Smoc1SPARC-related modular calcium-binding protein 1LNNTNVRnSEK
A479I Smoc1SPARC-related modular calcium-binding protein 1LNNTNVRnSEK
A479K Xlr5bX-linked lymphocyte-regulated 5BILQTAIEDHETK
A4802 Fat4Protocadherin Fat 4REYLLTqSIR
A4802 Fat4Protocadherin Fat 4qYSLTVqATDRGVPSLTGR
A4802 Fat4Protocadherin Fat 4KGFQInK
A4802 Fat4Protocadherin Fat 4AILqVVAR
A4802 Fat4Protocadherin Fat 4YFPATSR
A4802 Fat4Protocadherin Fat 4DqATVHVYMK
A4802 Fat4Protocadherin Fat 4qFAIDSFSGqVTLVGK
A4802 Fat4Protocadherin Fat 4INATTGEIFnKqVLK
A4802 Fat4Protocadherin Fat 4FAnKADFPK
A480K Xlr4aX-linked lymphocyte-regulated 4ANLqAIKccR
A480K Xlr4aX-linked lymphocyte-regulated 4AAIIEEARK
A480K Xlr4aX-linked lymphocyte-regulated 4ANLqAIKccR
A4810 Fermt1Fermitin family homolog 1cGVqADAnLLFTPqHK
A481K Klra2Membrane protein Ly-49B (Killer cell lectin-like receptor 2)NSVPNREK
A481K Klra2Membrane protein Ly-49B (Killer cell lectin-like receptor 2)QEYQVMK
A481K Klra2Membrane protein Ly-49B (Killer cell lectin-like receptor 2)GcKqIcQAYnLTLLK
A481K Klra2Membrane protein Ly-49B (Killer cell lectin-like receptor 2)FPIPGScAK
A4825 Frmd4aFERM domain-containing protein 4AMPQMcKATSAALPQSqR
A4825 Frmd4aFERM domain-containing protein 4AMPQMcKATSAALPQSqR
A4825 Frmd4aFERM domain-containing protein 4AMPQMcKATSAALPQSqR
A4826 Frmd4bFERM domain-containing protein 4BSFHEDEVDR
A4826 Frmd4bFERM domain-containing protein 4BSFHEDEVDR
A482C Sec61bProtein transport protein Sec61 subunit betaTTSAGTGGMWR
A482C Sec61bProtein transport protein Sec61 subunit betaFYTEDSPGLK
A482C Sec61bProtein transport protein Sec61 subunit betaTTSAGTGGMWR
A482H Naf1H/ACA ribonucleoprotein complex non-core subunit NAF1SHGRPPPQQYYnSDHmASQESLGFTPQR
A4834 Gcc1GRIP and coiled-coil domain-containing protein 1AQEQSDHALMLR
A4834 Gcc1GRIP and coiled-coil domain-containing protein 1ERLLqLDLEnK
A4847 Gp5Platelet glycoprotein VGLLGAQVKLEK
A4847 Gp5Platelet glycoprotein VLLLEAmGKScN
A4847 Gp5Platelet glycoprotein VNLQELGLNQnqLSFLPAnLFSSLR
A484C Slc6a5Sodium- and chloride-dependent glycine transporter 2qPANILEAAVPGHRDSPR
A484C Slc6a5Sodium- and chloride-dependent glycine transporter 2SASTGAqTFqSADAR
A4856 Hspb1Heat shock protein beta-1QLSSGVSEIR
A4856 Hspb1Heat shock protein beta-1EGVVEITGK
A4856 Hspb1Heat shock protein beta-1QLSSGVSEIR
A4856 Hspb1Heat shock protein beta-1EGVVEITGK
A4857 Igfbp7Insulin-like growth factor-binding protein 7TELLPGDRENLAIQTR
A4857 Igfbp7Insulin-like growth factor-binding protein 7DAcGccPVcAR
A4857 Igfbp7Insulin-like growth factor-binding protein 7EDAGEYEcHASNSQGQASAAAK
A4857 Igfbp7Insulin-like growth factor-binding protein 7ITVVDALHEIPLK
A4857 Igfbp7Insulin-like growth factor-binding protein 7TELLPGDRENLAIQTR
A4857 Igfbp7Insulin-like growth factor-binding protein 7EDAGEYEcHASNSQGQASAAAK
A4857 Igfbp7Insulin-like growth factor-binding protein 7ITVVDALHEIPLK
A4857 Igfbp7Insulin-like growth factor-binding protein 7MPAARAcRPPAPR
A485H Nlrp14NACHT, LRR and PYD domains-containing protein 14TMRLTAR
A485H Nlrp14NACHT, LRR and PYD domains-containing protein 14LLSHTLK
A485H Nlrp14NACHT, LRR and PYD domains-containing protein 14TMRLTAR
A4866 IncenpInner centromere proteinqIEqKFAQIDEK
A4866 IncenpInner centromere proteinEEqQRLAEQQLQEEQAK
A4866 IncenpInner centromere proteinEEqqRLAEQQLQEEQAK
A4866 IncenpInner centromere proteinVLqARER
A4867 Inf2Inverted formin-2SGqLLWEALEnLVnR
A4867 Inf2Inverted formin-